CNTROB Antibody


Immunohistochemistry-Paraffin: CNTROB Antibody [NBP1-82834] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells and cells in seminiferous ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CNTROB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
Specificity of human CNTROB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
CNTROB Protein (NBP1-82834PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CNTROB Antibody

  • centrobin, centrosomal BRCA2 interacting protein
  • centrosomal BRCA2 interacting protein
  • Centrosomal BRCA2-interacting protein
  • LIP8centrobin
  • LYST-interacting protein 8
  • LYST-interacting protein LIP8
  • PP1221


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IP, PLA, ICC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for CNTROB Antibody (NBP1-82834) (0)

There are no publications for CNTROB Antibody (NBP1-82834).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNTROB Antibody (NBP1-82834) (0)

There are no reviews for CNTROB Antibody (NBP1-82834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNTROB Antibody (NBP1-82834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CNTROB Products

Bioinformatics Tool for CNTROB Antibody (NBP1-82834)

Discover related pathways, diseases and genes to CNTROB Antibody (NBP1-82834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNTROB Antibody (NBP1-82834)

Discover more about diseases related to CNTROB Antibody (NBP1-82834).

Pathways for CNTROB Antibody (NBP1-82834)

View related products by pathway.

PTMs for CNTROB Antibody (NBP1-82834)

Learn more about PTMs related to CNTROB Antibody (NBP1-82834).

Research Areas for CNTROB Antibody (NBP1-82834)

Find related products by research area.

Blogs on CNTROB

There are no specific blogs for CNTROB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CNTROB Antibody and receive a gift card or discount.


Gene Symbol CNTROB