CNOT7 Antibody (2F6) - Azide and BSA Free Summary
| Immunogen |
CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS |
| Specificity |
CNOT7 - CCR4-NOT transcription complex, subunit 7 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CNOT7 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Publications |
|
Reactivity Notes
Human, Mouse, & Rat. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CNOT7 Antibody (2F6) - Azide and BSA Free
Background
The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for CNOT7 Antibody (H00029883-M01)(7)
Showing Publications 1 -
7 of 7.
| Publications using H00029883-M01 |
Applications |
Species |
| Toru S, Miyuki H, Saori N et al. Regulation of CCR4-NOT complex deadenylase activity and cellular responses by MK2-dependent phosphorylation of CNOT2. RNA Biol. 2022-02-06 [PMID: 35129087] |
|
|
| Shohei T, Akiko Y, Haytham M et al. Neuronal XRN1 is required for maintenance of whole-body metabolic homeostasis. iScience. 2021-10-22 [PMID: 34646989] |
|
|
| Yi H, Park J, Ha M et al. PABP Cooperates with the CCR4-NOT Complex to Promote mRNA Deadenylation and Block Precocious Decay. Mol Cell 2018-06-21 [PMID: 29932901] |
|
|
| Sheu-Gruttadauria J, MacRae IJ., et al. Phase Transitions in the Assembly and Function of Human miRISC. Cell 2018-03-16 [PMID: 29576456] |
|
|
| Inoue T, Morita M, Hijikata A et al. CNOT3 contributes to early B cell development by controlling Igh rearrangement and p53 mRNA stability. J Exp Med. 2015-08-03 [PMID: 26238124] |
|
|
| Chekulaeva M, Mathys H, Zipprich JT et al. miRNA repression involves GW182-mediated recruitment of CCR4-NOT through conserved W-containing motifs. Nat Struct Mol Biol. 2011-10-07 [PMID: 21984184] |
|
|
| Marchese FP, Aubareda A, Tudor C et al. MAPKAP Kinase 2 Blocks Tristetraprolin-directed mRNA Decay by Inhibiting CAF1 Deadenylase Recruitment. J Biol Chem. 2010-07-01 [PMID: 20595389] |
|
|
Reviews for CNOT7 Antibody (H00029883-M01) (0)
There are no reviews for CNOT7 Antibody (H00029883-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CNOT7 Antibody (H00029883-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CNOT7 Products
Blogs on CNOT7