CNOT6L Antibody

Images

 
Western Blot: CNOT6L Antibody [NBP1-84186] - Analysis in human cell line MOLT-4.
Immunocytochemistry/ Immunofluorescence: CNOT6L Antibody [NBP1-84186] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CNOT6L Antibody [NBP1-84186] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNOT6L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVHKELFGAGMKPIHAADKQLLIVANAHMH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNOT6L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CNOT6L Protein (NBP1-84186PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNOT6L Antibody

  • Carbon catabolite repressor protein 4 homolog B
  • CCR4b
  • CCR4-NOT transcription complex subunit 6-like
  • CCR4-NOT transcription complex, subunit 6-like
  • DKFZp434K098
  • EC 3.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5228
Species: Hu
Applications: WB
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89098
Species: Hu
Applications: WB, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP2-46586
Species: Hu
Applications: IHC
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31686
Species: Hu
Applications: WB, ICC/IF

Publications for CNOT6L Antibody (NBP1-84186) (0)

There are no publications for CNOT6L Antibody (NBP1-84186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT6L Antibody (NBP1-84186) (0)

There are no reviews for CNOT6L Antibody (NBP1-84186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CNOT6L Antibody (NBP1-84186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNOT6L Products

Bioinformatics Tool for CNOT6L Antibody (NBP1-84186)

Discover related pathways, diseases and genes to CNOT6L Antibody (NBP1-84186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNOT6L Antibody (NBP1-84186)

Discover more about diseases related to CNOT6L Antibody (NBP1-84186).
 

Pathways for CNOT6L Antibody (NBP1-84186)

View related products by pathway.

PTMs for CNOT6L Antibody (NBP1-84186)

Learn more about PTMs related to CNOT6L Antibody (NBP1-84186).

Blogs on CNOT6L

There are no specific blogs for CNOT6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNOT6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT6L