CNOT6L Antibody

Product Discontinued

CNOT6L Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVHKELFGAGMKPIHAADKQLLIVANAHMH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNOT6L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CNOT6L Antibody

• Carbon catabolite repressor protein 4 homolog B
• CCR4b
• CCR4-NOT transcription complex subunit 6-like
• CCR4-NOT transcription complex, subunit 6-like
• DKFZp434K098
• EC 3.1

Background

CNOT6L plays a role in the deadenylation of mRNAs in the cytoplasm. Has 3'-5' poly(A) exoribonuclease activity forsynthetic poly(A) RNA substrate. May be involved in the deadenylation-dependent degradation of mRNAs through the3'-UTR AU-rich element-mediated mech

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNOT6L