Recombinant Human CNOT4 Protein

Images

 
SDS-Page: Recombinant Human CNOT4 Protein [H00004850-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human CNOT4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 52-150 of Human CNOT4

Source: Wheat Germ

Amino Acid Sequence: LCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CNOT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CNOT4 Protein

  • CCR4-associated factor 4
  • CCR4-NOT transcription complex, subunit 4
  • E3 ubiquitin-protein ligase CNOT4
  • EC 6.3.2.-
  • NOT4yeast) homolog

Background

CNOT4 - CCR4-NOT transcription complex, subunit 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56034
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
E2-622
Species: Hu
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP, KO
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004849-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, KO
NBP2-65611
Species: Hu
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF

Publications for CNOT4 Partial Recombinant Protein (H00004850-Q01) (0)

There are no publications for CNOT4 Partial Recombinant Protein (H00004850-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNOT4 Partial Recombinant Protein (H00004850-Q01) (0)

There are no reviews for CNOT4 Partial Recombinant Protein (H00004850-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNOT4 Partial Recombinant Protein (H00004850-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CNOT4 Partial Recombinant Protein (H00004850-Q01)

Discover related pathways, diseases and genes to CNOT4 Partial Recombinant Protein (H00004850-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CNOT4 Partial Recombinant Protein (H00004850-Q01)

View related products by pathway.

PTMs for CNOT4 Partial Recombinant Protein (H00004850-Q01)

Learn more about PTMs related to CNOT4 Partial Recombinant Protein (H00004850-Q01).

Blogs on CNOT4

There are no specific blogs for CNOT4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UbcH5b/UBE2D2
E2-622-100
CNOT4 Antibody
NBP2-24527

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CNOT4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CNOT4