CNNM4 Antibody

Images

 
Immunohistochemistry-Paraffin: CNNM4 Antibody [NBP1-89280] - Staining of human appendix shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CNNM4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNNM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CNNM4 Protein (NBP1-89280PEP)
Publications
Read Publication using NBP1-89280.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CNNM4 Antibody

  • ACDP4cyclin-M4
  • Ancient conserved domain-containing protein 4
  • cyclin M4
  • Cyclin-M4
  • FLJ37746
  • FLJ42791
  • KIAA1592ancient conserved domain protein 4
  • metal transporter CNNM4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89281
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57086
Species: Hu
Applications: WB, ICC/IF
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP1-90272
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
H00140803-R03
Species: Hu
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-14617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl

Publications for CNNM4 Antibody (NBP1-89280)(1)

Reviews for CNNM4 Antibody (NBP1-89280) (0)

There are no reviews for CNNM4 Antibody (NBP1-89280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CNNM4 Antibody (NBP1-89280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CNNM4 Products

CNNM4 NBP1-89280

Bioinformatics Tool for CNNM4 Antibody (NBP1-89280)

Discover related pathways, diseases and genes to CNNM4 Antibody (NBP1-89280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CNNM4 Antibody (NBP1-89280)

Discover more about diseases related to CNNM4 Antibody (NBP1-89280).
 

Pathways for CNNM4 Antibody (NBP1-89280)

View related products by pathway.

Research Areas for CNNM4 Antibody (NBP1-89280)

Find related products by research area.

Blogs on CNNM4

There are no specific blogs for CNNM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CNNM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNNM4