CLPP Antibody (3E2.)

Images

 
Western Blot: CLPP Antibody (3E2) [H00008192-M01] - CLPP monoclonal antibody (M01), clone 3E2. Analysis of CLPP expression in PC-12.
Immunohistochemistry-Paraffin: CLPP Antibody (3E2) [H00008192-M01] - Analysis of monoclonal antibody to CLPP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1 ug/ml.
Western Blot: CLPP Antibody (3E2) [H00008192-M01] - CLPP monoclonal antibody (M01), clone 3E2 Analysis of CLPP expression in A-431.
Sandwich ELISA: CLPP Antibody (3E2) [H00008192-M01] - Detection limit for recombinant GST tagged CLPP is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLPP Antibody (3E2.) Summary

Immunogen
CLPP (NP_006003 178 a.a. - 277 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Specificity
CLPP - ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLPP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.
Publications
Read Publication using H00008192-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLPP Antibody (3E2.)

  • ATP-dependent protease ClpAP, proteolytic subunit, human
  • ClpP (caseinolytic protease, ATP-dependent, proteolytic subunit, E. coli)homolog
  • ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E.coli)
  • ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog (E.coli)
  • ClpP caseinolytic protease, ATP-dependent, proteolytic subunit homolog
  • EC 3.4.21.92
  • Endopeptidase Clp
  • putative ATP-dependent Clp protease proteolytic subunit, mitochondrial

Background

The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89478
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54851
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-83703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16890
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00050945-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-86109
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-49499
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CLPP Antibody (H00008192-M01)(1)


Reviews for CLPP Antibody (H00008192-M01) (0)

There are no reviews for CLPP Antibody (H00008192-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLPP Antibody (H00008192-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLPP Products

Bioinformatics Tool for CLPP Antibody (H00008192-M01)

Discover related pathways, diseases and genes to CLPP Antibody (H00008192-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLPP Antibody (H00008192-M01)

Discover more about diseases related to CLPP Antibody (H00008192-M01).
 

Pathways for CLPP Antibody (H00008192-M01)

View related products by pathway.

PTMs for CLPP Antibody (H00008192-M01)

Learn more about PTMs related to CLPP Antibody (H00008192-M01).
 

Research Areas for CLPP Antibody (H00008192-M01)

Find related products by research area.

Blogs on CLPP

There are no specific blogs for CLPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLPP Antibody (3E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLPP
Entrez
OMIM
Uniprot