Home » CLPB » CLPB Proteins » CLPB Recombinant Protein Antigen

CLPB Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLPB Protein (NBP2-32629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CLPB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLPB.

Source: E.coli

Amino Acid Sequence: GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWA
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLPB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32629.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CLPB Recombinant Protein Antigen

  • caseinolytic peptidase B protein homolog
  • ClpB caseinolytic peptidase B homolog (E. coli)
  • HSP78SKD3FLJ13152
  • Suppressor of potassium transport defect 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLPP Antibody
NBP1-89557
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
HspA4 Antibody
(SD0861)
NBP2-67817
Flow Cytometry: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of Hela cells with HSPA4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Coactosin-like
Protein 1/CotL1 Antib
AF7865
Western blot shows lysates of JAR human choriocarcinoma cell line, NCI‑H345 human small cell lung carcinoma cell line, human placenta tissue, and rat placenta tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Coactosin-like Protein 1/COTL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7865) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Coactosin-like Protein 1/COTL1 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Coactosin-like Protein 1/COTL1 was detected in immersion fixed NCI‑H128 human small cell lung carcinoma cell line using Sheep Anti-Human/Mouse/Rat Coactosin-like Protein 1/COTL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7865) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu, Rt
Applications: ICC, WB
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
CALML3 Antibody
(2A11)
H00000810-M04
Western Blot: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of CALML3 expression in transfected 293T cell line by CALML3 monoclonal antibody (M04), clone 2A11. Lane 1: CALML3 transfected lysatE (16.9 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of monoclonal antibody to CALML3 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of monoclonal antibody to CALML3 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 12 ug/ml
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
DNAJB6 Antibody
(2C11-C1)
H00010049-M01
ELISA: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - Detection limit for recombinant GST tagged DNAJB6 is approximately 1ng/ml as a capture antibody.
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - DNAJB6 monoclonal antibody (M01), clone 2C11-C1. Analysis of DNAJB6 expression in C32.
Western Blot: DNAJB6 Antibody (2C11-C1) [H00010049-M01] - Analysis of DNAJB6 expression in transfected 293T cell line by DNAJB6 monoclonal antibody (M01), clone 2C11-C1.Lane 1: DNAJB6 transfected lysate(27 KDa).Lane 2: Non-transfected lysate.
(8 Publications)
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
DNAJA2 Antibody
(OTI3A10)
NBP2-02996
Flow Cytometry: DNAJA2 Antibody (3A10) [NBP2-02996] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DNAJA2 antibody, and then analyzed by flow cytometry.
Western Blot: DNAJA2 Antibody (3A10) [NBP2-02996] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DNAJA2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DNAJA2.
Immunohistochemistry-Paraffin: DNAJA2 Antibody (3A10) [NBP2-02996] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-DNAJA2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody - BSA Free [NBP1-77397] - Mouse MS1 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 2ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(4 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
LONP1 Antibody
NBP1-81734
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
(13 Publications)
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CLPX Antibody
NBP1-89478
Immunocytochemistry/Immunofluorescence: CLPX Antibody [NBP1-89478] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: CLPX Antibody [NBP1-89478] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: CLPX Antibody [NBP1-89478] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Aquaporin-9
Antibody
NBP3-12260
Immunohistochemistry-Paraffin: Aquaporin-9 Antibody [NBP3-12260] - Rat Kidney-Aquaporin 9. 1:100 dilution inIHC Blocking Buffer. DAB (brown) straining and Hematoxylin in QS (blue) counterstain. 40x magnification on Leica DM4000. FFPE section.
Immunohistochemistry-Paraffin: Aquaporin-9 Antibody [NBP3-12260] - Rat Kidney-Aquaporin 9. 1:100 dilution in IHC Blocking Buffer. DAB (brown) straining and Hematoxylin QS (blue) counterstain. 5x Magnification on Leica DM4000 FFPE Section.
Western Blot: Aquaporin-9 Antibody [NBP3-12260] - WB NBP3-12260. 1:500 antibody dilution in DiluObuffer. Apparent MW is 29-30 kDa.
Species: Bv, Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ELOVL1 Antibody
NBP2-37956
Immunohistochemistry-Paraffin: ELOVL1 Antibody [NBP2-37956] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ELOVL1 Antibody [NBP2-37956] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ELOVL1 Antibody [NBP2-37956] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HSP40/DNAJB1
Antibody (OTI1F9)
NBP2-03433
Flow Cytometry: Hsp40/DNAJB1 Antibody (1F9) [NBP2-03433] - Hsp40/DNAJB1 Antibody (1F9) HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Hsp40 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Hsp40/DNAJB1 Antibody (1F9) [NBP2-03433] - Hsp40/DNAJB1 Antibody (1F9) Staining of COS7 cells transiently transfected by pCMV6-ENTRY Hsp40.
Immunohistochemistry-Paraffin: Hsp40/DNAJB1 Antibody (1F9) [NBP2-03433] - Hsp40/DNAJB1 Antibody (1F9) Staining of paraffin-embedded Human prostate tissue using anti-Hsp40 mouse monoclonal antibody.
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TBX22 Antibody
(1A10)
H00050945-M01
Immunohistochemistry-Paraffin: TBX22 Antibody (1A10) [H00050945-M01] - Analysis of monoclonal antibody to TBX22 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml.
Western Blot: TBX22 Antibody (1A10) [H00050945-M01] - Analysis of TBX22 expression in transfected 293T cell line by TBX22 monoclonal antibody (M01), clone 1A10.Lane 1: TBX22 transfected lysate (Predicted MW: 57.9 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: TBX22 Antibody (1A10) [H00050945-M01] - Detection limit for recombinant GST tagged TBX22 is 0.3 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
HSP10/EPF Antibody
(0H0X6)
NBP3-16604
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded rat brain using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human colon using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human placenta using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSP27 Antibody -
BSA Free
NBP1-75477
Knockout Validated: HSP27 Antibody [NBP1-75477] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and HSP27 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Rabbit Anti-Human HSP27 Polyclonal Antibody (Catalog # NBP1-75477) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (catalog number HAF008). Specific band was detected for HSP27 at approximately 27 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: HSP27 Antibody [NBP1-75477] - Hsp27 Antibody [NBP1-75477] - HSP27 antibody was tested in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: Hsp27 Antibody [NBP1-75477] - Staining of HSP27 in mouse heart using DAB with hematoxylin counterstain.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
ME3 Antibody
NBP1-85871
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human endometrium shows moderate granular cytoplasmic positivity.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ME3 Antibody [NBP1-85871] - Staining of human testis shows moderate to strong granular cytoplasmic positivity.
Species: Hu
Applications: IHC, IHC-P, WB
ME1 Antibody
NBP1-32398
Western Blot: ME1 Antibody [NBP1-32398] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with ME1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: ME1 Antibody [NBP1-32398] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Western Blot: ME1 Antibody [NBP1-32398] - Sample (30 ug of whole cell lysate) A: NIH-3T3 B: JC C: BCL-1 7. 5% SDS PAGE; antibody diluted at 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(48 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
CLPB Recombinant
Protein Antigen
NBP2-32629PEP
CLPB Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CLPB Protein (NBP2-32629PEP) (0)

There are no publications for CLPB Protein (NBP2-32629PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLPB Protein (NBP2-32629PEP) (0)

There are no reviews for CLPB Protein (NBP2-32629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLPB Protein (NBP2-32629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLPB Products

Bioinformatics Tool for CLPB Protein (NBP2-32629PEP)

Discover related pathways, diseases and genes to CLPB Protein (NBP2-32629PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLPB Protein (NBP2-32629PEP)

Discover more about diseases related to CLPB Protein (NBP2-32629PEP).
 

Pathways for CLPB Protein (NBP2-32629PEP)

View related products by pathway.

PTMs for CLPB Protein (NBP2-32629PEP)

Learn more about PTMs related to CLPB Protein (NBP2-32629PEP).
 

Research Areas for CLPB Protein (NBP2-32629PEP)

Find related products by research area.

Blogs on CLPB

There are no specific blogs for CLPB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLPB Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLPB