CLP24/TMEM204 Antibody


Western Blot: TMEM204 Antibody [NBP1-88444] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: TMEM204 Antibody [NBP1-88444] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CLP24/TMEM204 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Specificity of human CLP24/TMEM204 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLP24/TMEM204 Protein (NBP1-88444PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CLP24/TMEM204 Antibody

  • C16orf30
  • C16orf30chromosome 16 open reading frame 30
  • Claudin-like protein 24
  • CLP24
  • CLP24MGC111564
  • FLJ20898
  • TMEM204
  • transmembrane protein 204


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ChIP, Flow, IHC-P, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, IP
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CLP24/TMEM204 Antibody (NBP1-88444) (0)

There are no publications for CLP24/TMEM204 Antibody (NBP1-88444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLP24/TMEM204 Antibody (NBP1-88444) (0)

There are no reviews for CLP24/TMEM204 Antibody (NBP1-88444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLP24/TMEM204 Antibody (NBP1-88444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CLP24/TMEM204 Products

Bioinformatics Tool for CLP24/TMEM204 Antibody (NBP1-88444)

Discover related pathways, diseases and genes to CLP24/TMEM204 Antibody (NBP1-88444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLP24/TMEM204 Antibody (NBP1-88444)

Discover more about diseases related to CLP24/TMEM204 Antibody (NBP1-88444).

Pathways for CLP24/TMEM204 Antibody (NBP1-88444)

View related products by pathway.

PTMs for CLP24/TMEM204 Antibody (NBP1-88444)

Learn more about PTMs related to CLP24/TMEM204 Antibody (NBP1-88444).

Blogs on CLP24/TMEM204

There are no specific blogs for CLP24/TMEM204, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CLP24/TMEM204 Antibody and receive a gift card or discount.


Gene Symbol TMEM204