CLK3 Antibody (5B2)

Images

 
Western Blot: CLK3 Antibody (5B2) [H00001198-M04] - Analysis of CLK3 expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/ Immunofluorescence: CLK3 Antibody (5B2) [H00001198-M04] - Analysis of monoclonal antibody to CLK3 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CLK3 Antibody (5B2) [H00001198-M04] - Analysis of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
5B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CLK3 Antibody (5B2) Summary

Immunogen
CLK3 (AAH02555, 36 a.a. - 136 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Specificity
CLK3 - CDC-like kinase 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CLK3 Antibody (5B2)

  • CDC-like kinase 3PHCLK3
  • clk3
  • dual specificity protein kinase CLK3
  • EC 2.7.12.1
  • FLJ22858
  • PHCLK3/152

Background

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. Pseudogenes located on chromosomes 1 and 9 have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-81120
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-47506
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85731
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-27072
Species: Hu, Am, Bv, Ca, Eq, Op, Pm
Applications: WB, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB944
Species: Hu
Applications: WB, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-81761
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-30404
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB110-94452
Species: Hu, Ch, Mu(-), Rt(-)
Applications: WB, ICC/IF

Publications for CLK3 Antibody (H00001198-M04) (0)

There are no publications for CLK3 Antibody (H00001198-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLK3 Antibody (H00001198-M04) (0)

There are no reviews for CLK3 Antibody (H00001198-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLK3 Antibody (H00001198-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLK3 Products

Bioinformatics Tool for CLK3 Antibody (H00001198-M04)

Discover related pathways, diseases and genes to CLK3 Antibody (H00001198-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLK3 Antibody (H00001198-M04)

Discover more about diseases related to CLK3 Antibody (H00001198-M04).
 

Pathways for CLK3 Antibody (H00001198-M04)

View related products by pathway.

PTMs for CLK3 Antibody (H00001198-M04)

Learn more about PTMs related to CLK3 Antibody (H00001198-M04).
 

Research Areas for CLK3 Antibody (H00001198-M04)

Find related products by research area.

Blogs on CLK3

There are no specific blogs for CLK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLK3 Antibody (5B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLK3
Entrez
OMIM
Uniprot