Recombinant Human CLIC5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CLIC5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 91-190 of Human CLIC5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLIC5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLIC5 Protein

  • chloride intracellular channel 5
  • chloride intracellular channel 5A
  • chloride intracellular channel protein 5
  • CLIC5B
  • dJ447E21.4
  • FLJ90663
  • MST130
  • MSTP130

Background

Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIC5 specifically associates with the cytoskeleton of placenta microvilli.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89465
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3104
Species: Mu
Applications: WB, IHC
AF3159
Species: Mu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-88016
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CLIC5 Partial Recombinant Protein (H00053405-Q01) (0)

There are no publications for CLIC5 Partial Recombinant Protein (H00053405-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC5 Partial Recombinant Protein (H00053405-Q01) (0)

There are no reviews for CLIC5 Partial Recombinant Protein (H00053405-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIC5 Partial Recombinant Protein (H00053405-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLIC5 Products

Bioinformatics Tool for CLIC5 Partial Recombinant Protein (H00053405-Q01)

Discover related pathways, diseases and genes to CLIC5 Partial Recombinant Protein (H00053405-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC5 Partial Recombinant Protein (H00053405-Q01)

Discover more about diseases related to CLIC5 Partial Recombinant Protein (H00053405-Q01).
 

Pathways for CLIC5 Partial Recombinant Protein (H00053405-Q01)

View related products by pathway.

PTMs for CLIC5 Partial Recombinant Protein (H00053405-Q01)

Learn more about PTMs related to CLIC5 Partial Recombinant Protein (H00053405-Q01).

Blogs on CLIC5

There are no specific blogs for CLIC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CLIC5 Antibody (1E6)
H00053405-M03
ErbB2/Her2
1129-ER-050

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLIC5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC5