CLIC2 Antibody

Images

 
Western Blot: CLIC2 Antibody [NBP1-80058] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLIC2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human CLIC2. Peptide sequence SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLIC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CLIon Channel2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CLIC2 Antibody

  • chloride intracellular channel 2
  • chloride intracellular channel protein 2
  • XAP121CLIC2b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001192-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-56481
Species: Hu
Applications: ICC/IF
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-65898
Species: Hu
AF284
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
NBP2-38892
Species: Hu
Applications: WB, IHC, IHC-P
H00053405-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89465
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01798
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP1-80058
Species: Hu
Applications: WB

Publications for CLIC2 Antibody (NBP1-80058) (0)

There are no publications for CLIC2 Antibody (NBP1-80058).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIC2 Antibody (NBP1-80058) (0)

There are no reviews for CLIC2 Antibody (NBP1-80058). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLIC2 Antibody (NBP1-80058) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CLIC2 Antibody (NBP1-80058)

Discover related pathways, diseases and genes to CLIC2 Antibody (NBP1-80058). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLIC2 Antibody (NBP1-80058)

Discover more about diseases related to CLIC2 Antibody (NBP1-80058).
 

Pathways for CLIC2 Antibody (NBP1-80058)

View related products by pathway.

PTMs for CLIC2 Antibody (NBP1-80058)

Learn more about PTMs related to CLIC2 Antibody (NBP1-80058).

Blogs on CLIC2

There are no specific blogs for CLIC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLIC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLIC2
Uniprot