CLEC3A Antibody - BSA Free

Immunohistochemistry-Paraffin: CLEC3A Antibody [NBP2-30595] - Staining of human cerebral cortex shows strong cytoplasmic positivity, with a granular pattern in neuronal cells.

Immunofluorescence: CLEC3A Antibody [NBP2-30595] - Human tonsil was stained for Clec3A (red) and counterstained with DAPI. This image was submitted via customer review.

Immunohistochemistry-Paraffin: CLEC3A Antibody [NBP2-30595] -Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CLEC3A Antibody [NBP2-30595] -Staining of human cerebellum shows strong granular pattern cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: CLEC3A Antibody [NBP2-30595] -Staining of human skin show negative cytoplasmic positivity in fibroblasts as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLEC3A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLEC3A Antibody - BSA Free (NBP2-30595) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Validated from a verified customer review
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CLEC3A Protein (NBP2-30595PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLEC3A Antibody - BSA Free

• Cartilage-Derived C-Type Lectin
• CLEC3A
• CLECSF1
• C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 1 (cartilage-derived)
• C-type lectin domain family 3 member A
• C-type lectin domain family 3, member A
• C-type lectin superfamily member 1
• C-type lectin, superfamily member 1
• MGC129558
• MGC129559

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for CLEC3A Antibody (NBP2-30595) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Jan Martinek IF Human 02/02/2018

Summary

• Application: Immunofluorescence
• Sample Tested: Human Tonsil tissue
• Species: Human
• Lot: R61353

Comments

• Comments: Acetone fixation
  blocking with Fc blocker and background buster
  satining 1h incubation at room temp.

Bioinformatics

• Gene Symbol: CLEC3A
• Uniprot:
  • O75596()