CLEC14A Antibody

Immunocytochemistry/Immunofluorescence: CLEC14A Antibody [NBP2-56335] - Staining of human cell line HUVEC TERT2 shows localization to endoplasmic reticulum.

Product Discontinued

CLEC14A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC14A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLEC14A Antibody

• C14orf27
• CEG1
• chromosome 14 open reading frame 27
• CLEC14A
• ClECT and EGF-like domain containing protein
• C-type lectin domain family 14 member A
• C-type lectin domain family 14, member A
• EGF R5
• EGFR5
• EGFR-5
• Epidermal growth factor receptor 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLEC14A