Recombinant Human CLCN7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CLCN7 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CLCN7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CLCN7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CLCN7 Protein

  • chloride channel 7
  • Chloride channel protein 7
  • CLC-7
  • CLC7FLJ39644
  • FLJ26686
  • H(+)/Cl(-) exchange transporter 7
  • OPTA2FLJ46423
  • OPTB4

Background

CLCN7 - chloride channel 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00001185-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-89926
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30066
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00001188-P01
Species: Hu
NBP1-88529
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46842
Species: Hu
Applications: IHC, IHC-P

Publications for CLCN7 Partial Recombinant Protein (H00001186-Q01) (0)

There are no publications for CLCN7 Partial Recombinant Protein (H00001186-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCN7 Partial Recombinant Protein (H00001186-Q01) (0)

There are no reviews for CLCN7 Partial Recombinant Protein (H00001186-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCN7 Partial Recombinant Protein (H00001186-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLCN7 Products

Bioinformatics Tool for CLCN7 Partial Recombinant Protein (H00001186-Q01)

Discover related pathways, diseases and genes to CLCN7 Partial Recombinant Protein (H00001186-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCN7 Partial Recombinant Protein (H00001186-Q01)

Discover more about diseases related to CLCN7 Partial Recombinant Protein (H00001186-Q01).
 

Pathways for CLCN7 Partial Recombinant Protein (H00001186-Q01)

View related products by pathway.

PTMs for CLCN7 Partial Recombinant Protein (H00001186-Q01)

Learn more about PTMs related to CLCN7 Partial Recombinant Protein (H00001186-Q01).

Blogs on CLCN7

There are no specific blogs for CLCN7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CLCN7 Antibody
NBP2-30021
TRANCE/TNFSF11/RANK L
462-TR-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CLCN7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCN7