CLCA1 Antibody

Images

 
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human testis.
Immunohistochemistry: CLCA1 Antibody [NBP2-49060] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human small intestine shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining in human small intestine and liver tissues using anti-CLCA1 antibody. Corresponding CLCA1 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human colon, liver, small intestine and testis using Anti-CLCA1 antibody NBP2-49060 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: CLCA1 Antibody [NBP2-49060] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLCA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VGMVTFDSAAHVQSELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTD
Specificity
Specificity of human CLCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLCA1 Recombinant Protein Antigen (NBP2-49060PEP)

Reactivity Notes

Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLCA1 Antibody

  • CaCC
  • CaCC-1
  • Calcium-activated chloride channel family member 1
  • Calcium-activated chloride channel protein 1
  • chloride channel accessory 1
  • chloride channel regulator 1
  • chloride channel regulator
  • chloride channel, calcium activated, family member 1
  • CLCA1
  • CLCRG1
  • FLJ95147
  • GOB5
  • hCaCC-1
  • HCLCA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-32841
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB300-164
Species: Hu, Po, Ca, Pm, Rt(-)
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Dual ISH-IHC
409-ML/CF
Species: Mu
NBP2-61701
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-33482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
NBP2-49060
Species: Hu
Applications: IHC, IHC-P

Publications for CLCA1 Antibody (NBP2-49060) (0)

There are no publications for CLCA1 Antibody (NBP2-49060).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCA1 Antibody (NBP2-49060) (0)

There are no reviews for CLCA1 Antibody (NBP2-49060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CLCA1 Antibody (NBP2-49060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CLCA1 Products

Array NBP2-49060

Bioinformatics Tool for CLCA1 Antibody (NBP2-49060)

Discover related pathways, diseases and genes to CLCA1 Antibody (NBP2-49060). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLCA1 Antibody (NBP2-49060)

Discover more about diseases related to CLCA1 Antibody (NBP2-49060).
 

Pathways for CLCA1 Antibody (NBP2-49060)

View related products by pathway.

PTMs for CLCA1 Antibody (NBP2-49060)

Learn more about PTMs related to CLCA1 Antibody (NBP2-49060).

Blogs on CLCA1

There are no specific blogs for CLCA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCA1