Claudin-14 Antibody (3D11)

Images

 
Sandwich ELISA: Claudin-14 Antibody (3D11) [H00023562-M01] - Detection limit for recombinant GST tagged CLDN14 is 0.3 ng/ml as a capture antibody.
Immunoprecipitation: Claudin-14 Antibody (3D11) [H00023562-M01] - Analysis of CLDN14 transfected lysate using anti-CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP, S-ELISA
Clone
3D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Claudin-14 Antibody (3D11) Summary

Immunogen
CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
Specificity
Reacts with claudin 14.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CLDN14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-14 Antibody (3D11)

  • claudin 14
  • Claudin14
  • Claudin-14
  • CLDN14
  • DFNB29
  • human CLDN14 gene10claudin-14

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-66784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002707-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB120-19347
Species: Bv, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP1-82470
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
H00024146-D01P
Species: Hu
Applications: WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5928
Species: Hu
Applications: ICC, IHC, WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: Flow, ICC/IF
DY262
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
H00023562-M01
Species: Hu
Applications: ELISA, IP, S-ELISA

Publications for Claudin-14 Antibody (H00023562-M01) (0)

There are no publications for Claudin-14 Antibody (H00023562-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-14 Antibody (H00023562-M01) (0)

There are no reviews for Claudin-14 Antibody (H00023562-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Claudin-14 Antibody (H00023562-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-14 Products

Bioinformatics Tool for Claudin-14 Antibody (H00023562-M01)

Discover related pathways, diseases and genes to Claudin-14 Antibody (H00023562-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-14 Antibody (H00023562-M01)

Discover more about diseases related to Claudin-14 Antibody (H00023562-M01).
 

Pathways for Claudin-14 Antibody (H00023562-M01)

View related products by pathway.

PTMs for Claudin-14 Antibody (H00023562-M01)

Learn more about PTMs related to Claudin-14 Antibody (H00023562-M01).
 

Research Areas for Claudin-14 Antibody (H00023562-M01)

Find related products by research area.

Blogs on Claudin-14

There are no specific blogs for Claudin-14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-14 Antibody (3D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN14
Entrez
Uniprot