Claudin-14 Antibody (3D11) - Azide and BSA Free

Sandwich ELISA: Claudin-14 Antibody (3D11) [H00023562-M01] - Detection limit for recombinant GST tagged CLDN14 is 0.3 ng/ml as a capture antibody.

Immunoprecipitation: Claudin-14 Antibody (3D11) [H00023562-M01] - Analysis of CLDN14 transfected lysate using anti-CLDN14 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CLDN14 MaxPab rabbit polyclonal antibody.

• Reactivity: Hu
• Applications: ELISA, IP
• Clone: 3D11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Claudin-14 Antibody (3D11) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Claudin-14 Antibody (3D11) - Azide and BSA Free (H00023562-M01) is a monoclonal antibody validated for use in ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
• Specificity: Reacts with claudin 14.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CLDN14
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
• Application Notes: This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Claudin-14 Antibody (3D11) - Azide and BSA Free

• claudin 14
• Claudin14
• Claudin-14
• CLDN14
• DFNB29
• human CLDN14 gene10claudin-14

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLDN14
• Entrez:
  • 23562(Human)
• Uniprot:
  • NP_036262()