CLASRP Recombinant Protein Antigen

Images

 
There are currently no images for CLASRP Protein (NBP2-32548PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CLASRP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLASRP.

Source: E.coli

Amino Acid Sequence: NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLASRP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32548.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CLASRP Recombinant Protein Antigen

  • CLASP
  • Clk4 Associating SR-Related Protein
  • CLK4-Associating Serine/Arginine Rich Protein
  • SFRS16
  • Splicing Factor, Arginine/Serine-Rich 16 (Suppressor-Of-White-ApricotHomolog, Drosophila)
  • Splicing Factor, Arginine/Serine-Rich 16
  • Suppressor Of White Apricot Homolog 2
  • Suppressor Of White-Apricot Homolog 2
  • SWAP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86214
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76881
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IP, ICC
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-84926
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-78217
Species: Hu
H00056899-P01
Species: Hu
NBP2-19676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
45500002
Species: Hu
Applications: WB, ELISA
NB100-858
Species: Hu, Mu, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NBP2-32548PEP
Species: Hu
Applications: AC

Publications for CLASRP Protein (NBP2-32548PEP) (0)

There are no publications for CLASRP Protein (NBP2-32548PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLASRP Protein (NBP2-32548PEP) (0)

There are no reviews for CLASRP Protein (NBP2-32548PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLASRP Protein (NBP2-32548PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLASRP Products

Array NBP2-32548PEP

Bioinformatics Tool for CLASRP Protein (NBP2-32548PEP)

Discover related pathways, diseases and genes to CLASRP Protein (NBP2-32548PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CLASRP

There are no specific blogs for CLASRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

nNOS Antibody
NB100-858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLASRP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CLASRP