CKS2 Antibody (2G12-2A5)

Western Blot: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M02), clone 2G12-2A5.Lane 1: CKS2 transfected lysate(9.9 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: CKS2 Antibody (2G12-2A5) [H00001164-M02] - Detection limit for recombinant GST tagged CKS2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 2G12-2A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

CKS2 Antibody (2G12-2A5) Summary

• Immunogen: CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
• Specificity: CKS2 (2G12-2A5)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CKS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CKS2 Antibody (2G12-2A5)

• CDC28 protein kinase 2
• CDC28 protein kinase regulatory subunit 2
• CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2
• CKS-2
• CKSHS2
• cyclin-dependent kinases regulatory subunit 2

Background

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKS2
• Entrez:
  • 1164(Human)
• OMIM:
  • 116901(Human)
• Uniprot:
  • AAH06458(Human)