CIZ1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1 (NP_036259). Peptide sequence YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CIZ1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
100 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CIZ1 Antibody - BSA Free
Background
CIZ1 (Cip1 interacting zinc-finger protein) was identified as a protein that associates with the cell-cycle inhibiting protein, p21 (Cip1/Waf1). CIZ1 is a member of the matrin 3 protein family and has been shown to bind DNA consensus sequences and co-localize with PCNA during replication. In breast cancer cells, CIZ1 was shown to associate with Cdk2 and dynein light chain 1 (DLC1), a cytoskeletal signaling protein involved in cell cycle regulation and tumorigenesis. Studies of the role of CIZ1 in breast tumorigenesis revealed that CIZ1 is an estrogen-responsive gene that functions as a coactivator of the estrogen receptor. Targeted depletion of CIZ1 inhibits entry into S-phase. This finding along with evidence that CIZ1 interacts with multiple cell cycle regulatory proteins and localizes to DNA replication foci, indicates that CIZ1 plays a critical role in the regulation of DNA replication.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Publications for CIZ1 Antibody (NBP3-10490) (0)
There are no publications for CIZ1 Antibody (NBP3-10490).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CIZ1 Antibody (NBP3-10490) (0)
There are no reviews for CIZ1 Antibody (NBP3-10490).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CIZ1 Antibody (NBP3-10490) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CIZ1 Products
Research Areas for CIZ1 Antibody (NBP3-10490)
Find related products by research area.
|
Blogs on CIZ1