CIZ1 Antibody - BSA Free

Western Blot: CIZ1 Antibody [NBP3-10490] - Western blot analysis using NBP3-10490 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CIZ1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CIZ1 Antibody - BSA Free (NBP3-10490) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1 (NP_036259). Peptide sequence YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIZ1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 100 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CIZ1 Antibody - BSA Free

• CDKN1A interacting zinc finger protein 1
• CDKN1A-interacting zinc finger protein 1
• cip1-interacting zinc finger protein
• LSFR1ZNF356Nuclear protein NP94
• NP94
• Zinc finger protein 356

Background

CIZ1 (Cip1 interacting zinc-finger protein) was identified as a protein that associates with the cell-cycle inhibiting protein, p21 (Cip1/Waf1). CIZ1 is a member of the matrin 3 protein family and has been shown to bind DNA consensus sequences and co-localize with PCNA during replication. In breast cancer cells, CIZ1 was shown to associate with Cdk2 and dynein light chain 1 (DLC1), a cytoskeletal signaling protein involved in cell cycle regulation and tumorigenesis. Studies of the role of CIZ1 in breast tumorigenesis revealed that CIZ1 is an estrogen-responsive gene that functions as a coactivator of the estrogen receptor. Targeted depletion of CIZ1 inhibits entry into S-phase. This finding along with evidence that CIZ1 interacts with multiple cell cycle regulatory proteins and localizes to DNA replication foci, indicates that CIZ1 plays a critical role in the regulation of DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIZ1