Recombinant Human CIDEB Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CIDEB Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-219 of Human CIDEB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CIDEB

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CIDEB Protein

  • cell death-inducing DFFA-like effector bcell death activator CIDE-B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-430
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-76950
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-13592
Species: Hu
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027141-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for CIDEB Recombinant Protein (H00027141-P02) (0)

There are no publications for CIDEB Recombinant Protein (H00027141-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIDEB Recombinant Protein (H00027141-P02) (0)

There are no reviews for CIDEB Recombinant Protein (H00027141-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIDEB Recombinant Protein (H00027141-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CIDEB Products

Bioinformatics Tool for CIDEB Recombinant Protein (H00027141-P02)

Discover related pathways, diseases and genes to CIDEB Recombinant Protein (H00027141-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIDEB Recombinant Protein (H00027141-P02)

Discover more about diseases related to CIDEB Recombinant Protein (H00027141-P02).
 

Pathways for CIDEB Recombinant Protein (H00027141-P02)

View related products by pathway.

PTMs for CIDEB Recombinant Protein (H00027141-P02)

Learn more about PTMs related to CIDEB Recombinant Protein (H00027141-P02).
 

Research Areas for CIDEB Recombinant Protein (H00027141-P02)

Find related products by research area.

Blogs on CIDEB

There are no specific blogs for CIDEB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CIDEB Antibody
NB100-55757

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CIDEB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CIDEB