CIAPIN1 Antibody (5G8)

Images

 
Western Blot: CIAPIN1 Antibody (5G8) [H00057019-M01] - CIAPIN1 monoclonal antibody (M01), clone 5G8 Analysis of CIAPIN1 expression in HepG2.
Western Blot: CIAPIN1 Antibody (5G8) [H00057019-M01] - CIAPIN1 monoclonal antibody (M01), clone 5G8. Analysis of CIAPIN1 expression in PC-12.
Western Blot: CIAPIN1 Antibody (5G8) [H00057019-M01] - CIAPIN1 monoclonal antibody (M01), clone 5G8. Analysis of CIAPIN1 expression in Raw 264.7.
Sandwich ELISA: CIAPIN1 Antibody (5G8) [H00057019-M01] - Detection limit for recombinant GST tagged CIAPIN1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CIAPIN1 Antibody (5G8) Summary

Immunogen
CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Specificity
CIAPIN1 - cytokine induced apoptosis inhibitor 1
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
CIAPIN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIAPIN1 Antibody (5G8)

  • Anamorsin
  • cytokine induced apoptosis inhibitor 1
  • Cytokine-induced apoptosis inhibitor 1
  • DRE2
  • Fe-S cluster assembly protein DRE2 homolog
  • predicted protein of HQ0915,2810413N20Rik
  • PRO0915

Background

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
AF7560
Species: Hu, Mu, Rt
Applications: IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF6457
Species: Hu
Applications: WB
203-IL/CF
Species: Hu
Applications: BA
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6108
Species: Hu
Applications: IHC
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-99532
Species: Mu
Applications: IHC, IHC-P
H00057019-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, S-ELISA

Publications for CIAPIN1 Antibody (H00057019-M01) (0)

There are no publications for CIAPIN1 Antibody (H00057019-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIAPIN1 Antibody (H00057019-M01) (0)

There are no reviews for CIAPIN1 Antibody (H00057019-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIAPIN1 Antibody (H00057019-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIAPIN1 Products

Bioinformatics Tool for CIAPIN1 Antibody (H00057019-M01)

Discover related pathways, diseases and genes to CIAPIN1 Antibody (H00057019-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIAPIN1 Antibody (H00057019-M01)

Discover more about diseases related to CIAPIN1 Antibody (H00057019-M01).
 

Pathways for CIAPIN1 Antibody (H00057019-M01)

View related products by pathway.

Research Areas for CIAPIN1 Antibody (H00057019-M01)

Find related products by research area.

Blogs on CIAPIN1

There are no specific blogs for CIAPIN1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIAPIN1 Antibody (5G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CIAPIN1
Entrez
OMIM
Uniprot