CIAPIN1 Antibody (5G8) Summary
Immunogen |
CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
Specificity |
CIAPIN1 - cytokine induced apoptosis inhibitor 1 |
Isotype |
IgG1 Lambda |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CIAPIN1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:100-1:2000
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CIAPIN1 Antibody (5G8)
Background
CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu
Applications: ICC/IF, IF, IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for CIAPIN1 Antibody (H00057019-M01) (0)
There are no publications for CIAPIN1 Antibody (H00057019-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CIAPIN1 Antibody (H00057019-M01) (0)
There are no reviews for CIAPIN1 Antibody (H00057019-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CIAPIN1 Antibody (H00057019-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CIAPIN1 Products
Bioinformatics Tool for CIAPIN1 Antibody (H00057019-M01)
Discover related pathways, diseases and genes to CIAPIN1 Antibody (H00057019-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CIAPIN1 Antibody (H00057019-M01)
Discover more about diseases related to CIAPIN1 Antibody (H00057019-M01).
| | Pathways for CIAPIN1 Antibody (H00057019-M01)
View related products by pathway.
|
Research Areas for CIAPIN1 Antibody (H00057019-M01)
Find related products by research area.
|
Blogs on CIAPIN1