CIAO1 Antibody

Images

 
Western Blot: CIAO1 Antibody [NBP2-84684] - WB Suggested Anti-WDR39 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysateCIAO1 is supported by BioGPS gene expression data to be ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIAO1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CIAO1. Peptide sequence: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CIAO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIAO1 Antibody

  • CIA1
  • cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae)
  • cytosolic iron-sulfur protein assembly 1
  • probable cytosolic iron-sulfur protein assembly protein CIAO1
  • WD repeat domain 39
  • WD repeat-containing protein 39
  • WD40 protein Ciao1
  • WDR39cytosolic iron-sulfur protein assembly 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47371
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20923
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02056
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-56087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-61683
Species: Hu
Applications: WB, ELISA, Flow
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82820
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02500
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-84684
Species: Hu
Applications: WB

Publications for CIAO1 Antibody (NBP2-84684) (0)

There are no publications for CIAO1 Antibody (NBP2-84684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIAO1 Antibody (NBP2-84684) (0)

There are no reviews for CIAO1 Antibody (NBP2-84684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIAO1 Antibody (NBP2-84684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CIAO1 Products

Bioinformatics Tool for CIAO1 Antibody (NBP2-84684)

Discover related pathways, diseases and genes to CIAO1 Antibody (NBP2-84684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIAO1 Antibody (NBP2-84684)

Discover more about diseases related to CIAO1 Antibody (NBP2-84684).
 

Pathways for CIAO1 Antibody (NBP2-84684)

View related products by pathway.

PTMs for CIAO1 Antibody (NBP2-84684)

Learn more about PTMs related to CIAO1 Antibody (NBP2-84684).
 

Research Areas for CIAO1 Antibody (NBP2-84684)

Find related products by research area.

Blogs on CIAO1

There are no specific blogs for CIAO1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIAO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIAO1