Recombinant Human CHURC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CHURC1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 112 of Human CHURC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCGDCVGKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CHURC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
38.06 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHURC1 Protein

  • C14orf52
  • chch
  • churchill domain containing 1
  • FLJ33064
  • FLJ51978
  • FLJ78804
  • My015
  • protein Churchill

Background

CHURC1( AAH20550, 1 a.a. - 113 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00131474-M01-100ug
Species: Hu
Applications: WB, ELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB300-613
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IM, IP
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu

Publications for CHURC1 Recombinant Protein (H00091612-P01) (0)

There are no publications for CHURC1 Recombinant Protein (H00091612-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHURC1 Recombinant Protein (H00091612-P01) (0)

There are no reviews for CHURC1 Recombinant Protein (H00091612-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHURC1 Recombinant Protein (H00091612-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CHURC1 Recombinant Protein (H00091612-P01)

Discover related pathways, diseases and genes to CHURC1 Recombinant Protein (H00091612-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHURC1 Recombinant Protein (H00091612-P01)

Discover more about diseases related to CHURC1 Recombinant Protein (H00091612-P01).
 

Pathways for CHURC1 Recombinant Protein (H00091612-P01)

View related products by pathway.

Blogs on CHURC1

There are no specific blogs for CHURC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CHURC1 Antibody
NBP1-94125

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHURC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CHURC1