CHTF8 Recombinant Protein Antigen

Images

 
There are currently no images for CHTF8 Protein (NBP2-30490PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CHTF8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHTF8.

Source: E. coli

Amino Acid Sequence: PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHTF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30490.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHTF8 Recombinant Protein Antigen

  • chromosome transmission fidelity protein 8 homolog
  • CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
  • CTF8hCTF8
  • Decreased expression in renal and prostate cancer protein
  • DERPCchromosome transmission fidelity factor 8 homolog
  • FLJ20400

Background

CHTF8 encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternative splicing results in multiple variants encoding different isoforms. This gene has a pseudogene on chromosome X. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 4 encode the same isoform (A).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03346
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00079075-B01P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-59904
Species: Hu
Applications: IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
AF3989
Species: Hu, Mu, Rt
Applications: WB
NBP2-93674
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001663-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF2147
Species: Mu
Applications: IHC, Simple Western, WB
NBP3-13066
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-03414
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB2878
Species: Hu
Applications: CyTOF-ready, Flow
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-30490PEP
Species: Hu
Applications: AC

Publications for CHTF8 Protein (NBP2-30490PEP) (0)

There are no publications for CHTF8 Protein (NBP2-30490PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHTF8 Protein (NBP2-30490PEP) (0)

There are no reviews for CHTF8 Protein (NBP2-30490PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHTF8 Protein (NBP2-30490PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHTF8 Products

Blogs on CHTF8

There are no specific blogs for CHTF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHTF8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHTF8