CHST8 Antibody - BSA Free

Western Blot: CHST8 Antibody [NBP2-87189] - Host: Rabbit. Target Name: CHST8. Sample Tissue: Hela Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHST8 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N region of human CHST8. Peptide sequence: APQQVPGIKFNIRPRQPHHDLPPGGSQDGDLKEPTERVTRDLSSGAPRGR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHST8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHST8 Antibody - BSA Free

• carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8
• carbohydrate sulfotransferase 8
• EC 2.8.2.-
• GalNAc-4-O-sulfotransferase 1
• GalNAc4ST
• GALNAC4ST1
• GALNAC-4-ST1
• galNAc4ST-1
• N-acetylgalactosamine-4-O-sulfotransferase 1

Background

Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates (Hiraoka et al., 2001 [PubMed 11445554]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHST8