CHRNB3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CHRNB3 Antibody - BSA Free (NBP1-91783) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: TGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHRNB3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CHRNB3 Antibody - BSA Free
Background
CHRNB3 is associated with subjective responses to tobacco. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator). Observational study and genome-wide association study of gene-disease association. (HuGE Navigator). Observational study of gene-disease association. (HuGE Navigator). absence of differences in the pharmacological profile of nicotinic receptor alpha3beta4 argues against role for incorporated beta3 subunit in formation of agonist binding sites while changes in channel kinetics suggest important effect on receptor gating
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Ch, Fi, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for CHRNB3 Antibody (NBP1-91783) (0)
There are no publications for CHRNB3 Antibody (NBP1-91783).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHRNB3 Antibody (NBP1-91783) (0)
There are no reviews for CHRNB3 Antibody (NBP1-91783).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CHRNB3 Antibody (NBP1-91783) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHRNB3 Products
Research Areas for CHRNB3 Antibody (NBP1-91783)
Find related products by research area.
|
Blogs on CHRNB3