Chorionic Gonadotropin beta Chain (hCG beta) Antibody Summary
| Immunogen |
This antibody was developed against a Recombinant Protein corresponding to amino acids: PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CGB3 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Chorionic Gonadotropin beta Chain (hCG beta) Antibody
Background
Human chorionic gonadotropin (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is stimulated to produce progesterone which in turn maintains the secretory endometrium. hCG is present only in trace amounts in non pregnant urine and sera. It rises sharply during pregnancy. HCG is composed of two non identical, non covalently linked polypeptide chains designated as the a and b subunits. The a subunit of HCG is nearly identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH) and luteinizing hormone (LH). A germ cell tumor which is positive for cytokeratin, placental alkaline phosphatase (PLAP) and HCG but negative for EMA and AFP is probably a choriocarcinoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Mu, Rt
Applications: ELISA, QFN
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)
There are no publications for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)
There are no reviews for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Chorionic Gonadotropin beta Chain (hCG beta) Products
Research Areas for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684)
Find related products by research area.
|
Blogs on Chorionic Gonadotropin beta Chain (hCG beta)