Chorionic Gonadotropin beta Chain (hCG beta) Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human cerebral cortex shows no positivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Chorionic Gonadotropin beta Chain (hCG beta) Antibody [NBP2-54684] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Order Details


    • Catalog Number
      NBP2-54684
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Chorionic Gonadotropin beta Chain (hCG beta) Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chorionic Gonadotropin beta Chain (hCG beta) Antibody

  • CGB
  • CGB3
  • CGB3choriogonadotropin subunit beta
  • CGB5
  • CGB7
  • CGB8
  • CG-Beta
  • Choriogonadotropin Subunit Beta
  • Chorionic gonadotrophin chain beta
  • chorionic gonadotropin beta 3 subunit
  • Chorionic Gonadotropin beta Chain
  • chorionic gonadotropin beta subunit
  • chorionic gonadotropin, beta polypeptide
  • hCGB

Background

Human chorionic gonadotropin (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is stimulated to produce progesterone which in turn maintains the secretory endometrium. hCG is present only in trace amounts in non pregnant urine and sera. It rises sharply during pregnancy. HCG is composed of two non identical, non covalently linked polypeptide chains designated as the a and b subunits. The a subunit of HCG is nearly identical to that of thyroid stimulating hormone (TSH), follicle stimulating hormone (FSH) and luteinizing hormone (LH). A germ cell tumor which is positive for cytokeratin, placental alkaline phosphatase (PLAP) and HCG but negative for EMA and AFP is probably a choriocarcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80782
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF4065
Species: Mu
Applications: IHC, WB
KA2332
Species: Mu, Rt
Applications: ELISA, QFN
MAB4169
Species: Hu
Applications: IHC, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33498
Species: Hu
Applications: IHC,  IHC-P
H00114336-M02
Species: Hu
Applications: ELISA, WB
NBP2-00521
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NB100-55735
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
NBP3-35061
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
DY523B-05
Species: Hu
Applications: ELISA
NBP2-46477
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NBP2-70360
Species: Hu
Applications: CyTOF-ready, Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP3-35390
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-53210
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-54684
Species: Hu
Applications: ICC/IF, IHC

Publications for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)

There are no publications for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)

There are no reviews for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Chorionic Gonadotropin beta Chain (hCG beta) Products

Research Areas for Chorionic Gonadotropin beta Chain (hCG beta) Antibody (NBP2-54684)

Find related products by research area.

Blogs on Chorionic Gonadotropin beta Chain (hCG beta)

There are no specific blogs for Chorionic Gonadotropin beta Chain (hCG beta), but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chorionic Gonadotropin beta Chain (hCG beta) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CGB3