CHORDC1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CHORDC1 Antibody [NBP1-85629] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CHORDC1 Antibody [NBP1-85629] - Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.

Analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CHORDC1 antibody. Corresponding CHORDC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHORDC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHORDC1 Antibody - BSA Free (NBP1-85629) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHORDC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CHORDC1 Protein (NBP1-85629PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHORDC1 Antibody - BSA Free

• CHORD domain-containing protein 1
• CHORD-containing protein 1
• CHP1CHP-1
• cysteine and histidine-rich domain (CHORD) containing 1
• cysteine and histidine-rich domain (CHORD)-containing 1
• cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1
• cysteine and histidine-rich domain-containing protein 1
• FLJ37289
• Protein morgana

Background

CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHORDC1