CHORDC1 Antibody


Orthogonal Strategies: Western Blot: CHORDC1 Antibody [NBP1-85629] - Analysis in human cell lines Caco-2 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: more
Immunocytochemistry/ Immunofluorescence: CHORDC1 Antibody [NBP1-85629] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CHORDC1 Antibody [NBP1-85629] - Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: CHORDC1 Antibody [NBP1-85629] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: CHORDC1 Antibody [NBP1-85629] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

CHORDC1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
Specificity of human, mouse, rat CHORDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHORDC1 Protein (NBP1-85629PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CHORDC1 Antibody

  • CHORD domain-containing protein 1
  • CHORD-containing protein 1
  • CHP1CHP-1
  • cysteine and histidine-rich domain (CHORD) containing 1
  • cysteine and histidine-rich domain (CHORD)-containing 1
  • cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1
  • cysteine and histidine-rich domain-containing protein 1
  • FLJ37289
  • Protein morgana


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHORDC1 Antibody (NBP1-85629) (0)

There are no publications for CHORDC1 Antibody (NBP1-85629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHORDC1 Antibody (NBP1-85629) (0)

There are no reviews for CHORDC1 Antibody (NBP1-85629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHORDC1 Antibody (NBP1-85629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CHORDC1 Products

Bioinformatics Tool for CHORDC1 Antibody (NBP1-85629)

Discover related pathways, diseases and genes to CHORDC1 Antibody (NBP1-85629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CHORDC1 Antibody (NBP1-85629)

View related products by pathway.

Research Areas for CHORDC1 Antibody (NBP1-85629)

Find related products by research area.

Blogs on CHORDC1

There are no specific blogs for CHORDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CHORDC1 Antibody and receive a gift card or discount.


Gene Symbol CHORDC1