Cholecystokinin-B R/CCKBR Antibody - BSA Free

Staining of human cell line HAP1 shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cholecystokinin-B R/CCKBR Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Cholecystokinin-B R/CCKBR using the following amino acid sequence: FMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGP
• Predicted Species: Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCKBR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cholecystokinin-B R/CCKBR Antibody - BSA Free

• CCK2 receptor
• CCK2R
• CCK2-R
• CCK-B receptor
• CCK-B
• CCKBR
• CCK-BR
• CCKRB
• cholecystokinin B receptor
• Cholecystokinin-2 receptor
• Cholecystokinin-B R
• cholecystokinin-B receptor/gastrin receptor
• CholecystokininBR
• Cholecystokinin-BR
• GASR
• Gastrin Receptor
• gastrin/cholecystokinin type B receptor

Background

CCKBR is a receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCKBR