Home » CHN 1 » CHN 1 Research Products » CHN 1 Antibody (3A3)

CHN 1 Antibody (3A3)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in HeLa(Cat # L013V1).
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in PC-12 (Cat # L012V1).
ELISA: CHN 1 Antibody (3A3) [H00001123-M03] - Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CHN 1 Antibody (3A3) Summary

Immunogen
CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP
Specificity
chimerin (chimaerin) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001123-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHN 1 Antibody (3A3)

  • a2-chimaerin
  • A-chimaerin
  • alpha-chimerin
  • ARHGAP2RhoGAP2
  • chimerin (chimaerin) 1
  • CHNDuane retraction syndrome 2
  • DURS2
  • NC
  • N-chimaerin
  • n-chimerin
  • Rho GTPase-activating protein 2
  • RHOGAP2

Background

This gene encodes GTPase-activating protein for p21-rac and a phorbol ester receptor. It plays an important role in ocular motor axon pathfinding. Heterozygous missense mutations in this gene cause Duane's retraction syndrome 2 (DURS2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(647 Publications)
Species: Hu
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Progesterone
R/NR3C3 Antibody (4E9
H00005241-M08
Western Blot: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of PGR expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/Immunofluorescence: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on MCF-7 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
TMEM37 Antibody
NBP2-47602
Immunocytochemistry/Immunofluorescence: TMEM37 Antibody [NBP2-47602] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus, nucleoli fibrillar center & cytosol.
Immunohistochemistry-Paraffin: TMEM37 Antibody [NBP2-47602] - Staining in human kidney and pancreas tissues using anti-TMEM37 antibody. Corresponding TMEM37 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TMEM37 Antibody [NBP2-47602] - Staining of human kidney shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
IL-4 [Unconjugated]
(3 Publications)
Species: Hu
ORL1/OPRL1 Antibody
NBP2-21065
Immunohistochemistry: ORL1/OPRL1 Antibody [NBP2-21065] - ORL1 (green) staining in rat brain (singulate cortex). DAPI was used to counterstain cell nuclei (blue color).
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Nociceptin Antibody
NBP2-58314
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human liver.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Immunohistochemical staining of human cerebral cortex shows no positivity.
Immunohistochemistry-Paraffin: Nociceptin Antibody [NBP2-58314] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: IHC, IHC-P
Tetraspanin-31
Antibody
NBP1-62311
Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Western Blot: Tetraspanin-31 Antibody [NBP1-62311] - Expressed in E. coli, concentration 1 ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
NANS Antibody
NBP1-87088
Western Blot: NANS Antibody [NBP1-87088] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: NANS Antibody [NBP1-87088] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NANS Antibody [NBP1-87088] - Staining of human pancreas shows strong nuclear and weaker cytoplasmic positivity.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Exosome component
10 Antibody
NBP1-32870
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with EXOSC10 antibody diluted at 1:5000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Exosome component 10 Antibody [NBP1-32870] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
Western Blot: Exosome component 10 Antibody [NBP1-32870] - Sample: 1000 ug 293T whole cell lysate/extract A. 30 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgG, C. Immunoprecipitation of EXOSC 10 protein by 2. 5 ug of EXOSC 10 antibody 7. 5% SDS-PAGE gel.
(2 Reviews)
(3 Publications)
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(22 Reviews)
(302 Publications)
Species: Hu
PMEL17/SILV
Antibody
NBP1-69571
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.
(7 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(38 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma.
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(19 Reviews)
(335 Publications)
Species: Hu
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, CyTOF-ready
Sialin/SLC17A5
Antibody
NBP2-20383
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
POMT1 GST (N-Term) Pr ...
H00010585-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu

Publications for CHN 1 Antibody (H00001123-M03)(1)


Reviews for CHN 1 Antibody (H00001123-M03) (0)

There are no reviews for CHN 1 Antibody (H00001123-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHN 1 Antibody (H00001123-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CHN 1 Products

Bioinformatics Tool for CHN 1 Antibody (H00001123-M03)

Discover related pathways, diseases and genes to CHN 1 Antibody (H00001123-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHN 1 Antibody (H00001123-M03)

Discover more about diseases related to CHN 1 Antibody (H00001123-M03).
 

Pathways for CHN 1 Antibody (H00001123-M03)

View related products by pathway.

PTMs for CHN 1 Antibody (H00001123-M03)

Learn more about PTMs related to CHN 1 Antibody (H00001123-M03).

Blogs on CHN 1

There are no specific blogs for CHN 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHN 1 Antibody (3A3) and receive a gift card or discount.


Bioinformatics

Gene Symbol CHN1
Entrez
OMIM
Uniprot