CHN 1 Antibody (3A3)

Images

 
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in HeLa(Cat # L013V1).
Western Blot: CHN 1 Antibody (3A3) [H00001123-M03] - Analysis of CHN1 expression in PC-12 (Cat # L012V1).
ELISA: CHN 1 Antibody (3A3) [H00001123-M03] - Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CHN 1 Antibody (3A3) Summary

Immunogen
CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP
Specificity
chimerin (chimaerin) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001123-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CHN 1 Antibody (3A3)

  • a2-chimaerin
  • A-chimaerin
  • alpha-chimerin
  • ARHGAP2RhoGAP2
  • chimerin (chimaerin) 1
  • CHNDuane retraction syndrome 2
  • DURS2
  • NC
  • N-chimaerin
  • n-chimerin
  • Rho GTPase-activating protein 2
  • RHOGAP2

Background

This gene encodes GTPase-activating protein for p21-rac and a phorbol ester receptor. It plays an important role in ocular motor axon pathfinding. Heterozygous missense mutations in this gene cause Duane's retraction syndrome 2 (DURS2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
NBP2-21065
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-58314
Species: Hu
Applications: IHC, IHC-P
NBP1-62311
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHN 1 Antibody (H00001123-M03)(1)


Reviews for CHN 1 Antibody (H00001123-M03) (0)

There are no reviews for CHN 1 Antibody (H00001123-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHN 1 Antibody (H00001123-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CHN 1 Products

Bioinformatics Tool for CHN 1 Antibody (H00001123-M03)

Discover related pathways, diseases and genes to CHN 1 Antibody (H00001123-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHN 1 Antibody (H00001123-M03)

Discover more about diseases related to CHN 1 Antibody (H00001123-M03).
 

Pathways for CHN 1 Antibody (H00001123-M03)

View related products by pathway.

PTMs for CHN 1 Antibody (H00001123-M03)

Learn more about PTMs related to CHN 1 Antibody (H00001123-M03).

Blogs on CHN 1

There are no specific blogs for CHN 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHN 1 Antibody (3A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHN1
Entrez
OMIM
Uniprot