CHMP7 Antibody

Images

 
Western Blot: CHMP7 Antibody [NBP1-81133] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human prostate shows strong nuclear positivity in glandular cells
Western Blot: CHMP7 Antibody [NBP1-81133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human duodenum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHMP7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTL
Specificity
Specificity of human CHMP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHMP7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. .
Control Peptide
Publications
Read Publication using NBP1-81133.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHMP7 Antibody

  • charged multivesicular body protein 7
  • CHMP family, member 7
  • Chromatin-modifying protein 7
  • MGC29816

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65248
Species: Hu
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55627
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5650
Species: Hu
Applications: WB, IHC
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP, In vitro
NBP1-81223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-2468
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85786
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54618
Species: Hu
Applications: WB, IHC
NBL1-09821
Species: Hu
NBP1-81133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CHMP7 Antibody (NBP1-81133)(1)

Reviews for CHMP7 Antibody (NBP1-81133) (0)

There are no reviews for CHMP7 Antibody (NBP1-81133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHMP7 Antibody (NBP1-81133). (Showing 1 - 1 of 1 FAQ).

  1. Is there a sample size available? Also, is this antibody suitable for mouse tissue?
    • Catalog # NBP1-81133 has only been tested in human so Novus can't guarantee it will work in other species. The concentration is 0.05mg/ml but you should always check the vial label for concentration.

Secondary Antibodies

 

Isotype Controls

Additional CHMP7 Products

Bioinformatics Tool for CHMP7 Antibody (NBP1-81133)

Discover related pathways, diseases and genes to CHMP7 Antibody (NBP1-81133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHMP7 Antibody (NBP1-81133)

Discover more about diseases related to CHMP7 Antibody (NBP1-81133).
 

Pathways for CHMP7 Antibody (NBP1-81133)

View related products by pathway.

PTMs for CHMP7 Antibody (NBP1-81133)

Learn more about PTMs related to CHMP7 Antibody (NBP1-81133).

Blogs on CHMP7

There are no specific blogs for CHMP7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHMP7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP7
Entrez