![Western Blot: CHMP7 Antibody [NBP1-81133] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-25](http://images.novusbio.com/fullsize/CHMP7-Antibody-Western-Blot-NBP1-81133-img0015.jpg "Western Blot: CHMP7 Antibody [NBP1-81133] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-25")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHMP7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. . |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Western_Blot_5795.jpg)
![Immunohistochemistry AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Immunohistochemistry_19609.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP1-81133 | Applications | Species |
|---|---|---|
| Kim SB, Kim HR, Park MC et al. Caspase-8 controls the secretion of inflammatory lysyl-tRNA synthetase in exosomes from cancer cells. J. Cell Biol. 2017-06-13 [PMID: 28611052] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CHMP7 Antibody (NBP1-81133)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human prostate shows strong nuclear positivity in glandular cells](http://images.novusbio.com/fullsize/CHMP7-Antibody-Immunohistochemistry-Paraffin-NBP1-81133-img0014.jpg "Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human prostate shows strong nuclear positivity in glandular cells")
![Western Blot: CHMP7 Antibody [NBP1-81133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/CHMP7-Antibody-Western-Blot-NBP1-81133-img0008.jpg "Western Blot: CHMP7 Antibody [NBP1-81133] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Western Blot: CHMP7 Antibody [NBP1-81133] - Analysis in human cell line Daudi.](http://images.novusbio.com/fullsize/CHMP7-Antibody-Western-Blot-NBP1-81133-img0010.jpg "Western Blot: CHMP7 Antibody [NBP1-81133] - Analysis in human cell line Daudi.")
![Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CHMP7-Antibody-Immunohistochemistry-Paraffin-NBP1-81133-img0011.jpg "Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CHMP7-Antibody-Immunohistochemistry-Paraffin-NBP1-81133-img0012.jpg "Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/CHMP7-Antibody-Immunohistochemistry-Paraffin-NBP1-81133-img0013.jpg "Immunohistochemistry-Paraffin: CHMP7 Antibody [NBP1-81133] - Staining of human duodenum shows strong nuclear positivity in glandular cells.")
