We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CHMP4C Recombinant Protein Antigen

Images

 
There are currently no images for CHMP4C Protein (NBP1-81166PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CHMP4C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHMP4C.

Source: E. coli

Amino Acid Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHMP4C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81166.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHMP4C Recombinant Protein Antigen

  • charged multivesicular body protein 4c
  • CHMP4c
  • chromatin modifying protein 4C
  • Chromatin-modifying protein 4c
  • hSnf7-3
  • hVps32-3
  • MGC22825
  • Shax3
  • SNF7 homolog associated with Alix 3
  • Snf7 homologue associated with Alix 3
  • SNF7-3
  • Vacuolar protein sorting-associated protein 32-3
  • Vps32-3
  • VPS32C

Background

CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49557
Species: Hu
Applications: IHC,  IHC-P
NBP1-91782
Species: Hu
Applications:  IHC-P, WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-13179
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89951
Species: Hu
Applications: ICC/IF, WB
NB200-112
Species: Ca, Ha, Hu, Pm, Mu, Po, Rt, Ze
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, KD, WB
AF638
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-82994
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-83726
Species: Hu
Applications: IHC,  IHC-P, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, In vitro, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP3-15638
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF496
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, WB
AF473
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-81166PEP
Species: Hu
Applications: AC

Publications for CHMP4C Protein (NBP1-81166PEP) (0)

There are no publications for CHMP4C Protein (NBP1-81166PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP4C Protein (NBP1-81166PEP) (0)

There are no reviews for CHMP4C Protein (NBP1-81166PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHMP4C Protein (NBP1-81166PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHMP4C Products

Blogs on CHMP4C

There are no specific blogs for CHMP4C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHMP4C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP4C