CHMP4B Recombinant Protein Antigen

Images

 
There are currently no images for CHMP4B Protein (NBP1-91782PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CHMP4B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHMP4B.

Source: E. coli

Amino Acid Sequence: SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHMP4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91782.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHMP4B Recombinant Protein Antigen

  • C20orf178
  • charged multivesicular body protein 4b
  • CHMP4A
  • CHMP4b
  • chromatin modifying protein 4B
  • Chromatin-modifying protein 4b
  • chromosome 20 open reading frame 178
  • dJ553F4.4
  • hSnf7-2
  • hVps32-2
  • Shax1
  • SNF7 homolog associated with Alix 1
  • Snf7 homologue associated with Alix 1
  • SNF7
  • SNF7-2CTPP3
  • Vacuolar protein sorting-associated protein 32-2
  • vacuolar protein-sorting-associated protein 32-2
  • Vps32-2
  • VPS32B

Background

Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in the escrt-iii complex, it probably serves as an acceptor for escrt-i complex on endosomal membranes. in case of infection, the hiv-1 virus takes advantage of the escrt-iii complex for budding and exocytic cargos of viral proteins, via the association of chmp4 proteins with pdcd6ip/aip1, a protein directly recruited by hiv-1 p6 protein that functions at sites of viral gag assembly and budding.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-83726
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-91780
Species: Hu
Applications: IHC,  IHC-P
NBP2-20881
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-77452
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-22183
Species: Hu, Mu, Rt
Applications: Flow, IHC, IP, WB
MAB6015
Species: Hu, Mu, Rt
Applications: WB
NBP1-81166
Species: Hu
Applications: IHC,  IHC-P
MAB7509
Species: Hu
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
NB100-2468
Species: Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-46283
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-86745
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85615
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB

Publications for CHMP4B Protein (NBP1-91782PEP) (0)

There are no publications for CHMP4B Protein (NBP1-91782PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHMP4B Protein (NBP1-91782PEP) (0)

There are no reviews for CHMP4B Protein (NBP1-91782PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHMP4B Protein (NBP1-91782PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHMP4B Products

Research Areas for CHMP4B Protein (NBP1-91782PEP)

Find related products by research area.

Blogs on CHMP4B

There are no specific blogs for CHMP4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHMP4B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHMP4B