ChGn Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to CHGN The peptide sequence was selected from the C terminal of CHGN.
Peptide sequence DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CSGALNACT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ChGn Antibody - BSA Free
Background
ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, mIF
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, IP, WB
Species: Mu
Applications: IP, WB
Species: ChHa, Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Publications for ChGn Antibody (NBP1-59219) (0)
There are no publications for ChGn Antibody (NBP1-59219).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ChGn Antibody (NBP1-59219) (0)
There are no reviews for ChGn Antibody (NBP1-59219).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ChGn Antibody (NBP1-59219) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ChGn Products
Research Areas for ChGn Antibody (NBP1-59219)
Find related products by research area.
|
Blogs on ChGn