CHD3 Antibody

Images

 
Immunohistochemistry-Paraffin: CHD3 Antibody [NBP2-14479] - Staining of human cerebral cortex shows distinct nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKIKLGLLGGKREKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGP VRTKKLKRGRPGRKKKKLLGCPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
CHD3 Protein (NBP2-14479PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHD3 Antibody

  • ATP-dependent helicase CHD3
  • CHD-3
  • chromodomain helicase DNA binding protein 3
  • chromodomain-helicase-DNA-binding protein 3
  • EC 3.6.1
  • EC 3.6.4.12
  • hZFH
  • Mi-2 autoantigen 240 kDa protein
  • Mi-2a
  • Mi2-ALPHA
  • ZFH
  • Zinc finger helicase
  • zinc-finger helicase (Snf2-like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-57521
Species: Hu, Mu
Applications: WB, IP
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
AF8519
Species: Hu, Mu, Rt
Applications: WB
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-60414
Species: Hu
Applications: WB, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-77393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-60411
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP2-32563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85660
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84492
Species: Hu
Applications: IHC, IHC-P
23320002
Species: Hu
Applications: ELISA, IHC-P
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-14479
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CHD3 Antibody (NBP2-14479) (0)

There are no publications for CHD3 Antibody (NBP2-14479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD3 Antibody (NBP2-14479) (0)

There are no reviews for CHD3 Antibody (NBP2-14479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CHD3 Antibody (NBP2-14479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHD3 Products

Bioinformatics Tool for CHD3 Antibody (NBP2-14479)

Discover related pathways, diseases and genes to CHD3 Antibody (NBP2-14479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHD3 Antibody (NBP2-14479)

Discover more about diseases related to CHD3 Antibody (NBP2-14479).
 

Pathways for CHD3 Antibody (NBP2-14479)

View related products by pathway.

PTMs for CHD3 Antibody (NBP2-14479)

Learn more about PTMs related to CHD3 Antibody (NBP2-14479).
 

Research Areas for CHD3 Antibody (NBP2-14479)

Find related products by research area.

Blogs on CHD3

There are no specific blogs for CHD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD3