![Western Blot: CHCHD2 Antibody [NBP1-94106] - Analysis in human cell lines A-431 and HeLa using anti-CHCHD2 antibody. Corresponding CHCHD2 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Western-Blot-NBP1-94106-img0015.jpg "Western Blot: CHCHD2 Antibody [NBP1-94106] - Analysis in human cell lines A-431 and HeLa using anti-CHCHD2 antibody. Corresponding CHCHD2 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit CHCHD2 Antibody - BSA Free (NBP1-94106) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CHCHD2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHCHD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
| Publications using NBP1-94106 | Applications | Species |
|---|---|---|
| Jan C. Lumibao, Payton L. Haak, Vladimir L. Kolossov, Jee-Wei Emily Chen, Jeremy Stutchman, Alejandra Ruiz, Mayandi Sivaguru, Jann N. Sarkaria, Brendan A.C. Harley, Andrew J. Steelman, H. Rex Gaskins CHCHD2 mediates glioblastoma cell proliferation, mitochondrial metabolism, hypoxia-induced invasion and therapeutic resistance International Journal of Oncology 2023-11-01 [PMID: 37654190] | ||
| Lumibao JC CHCHD2 and the tumor microenvironment in glioblastoma Thesis (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CHCHD2 Antibody (NBP1-94106)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CHCHD2 Antibody [NBP1-94106] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94106-img0010.jpg "Immunocytochemistry/Immunofluorescence: CHCHD2 Antibody [NBP1-94106] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP1-94106-img0020.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP1-94106-img0016.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human smooth muscle shows no positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP1-94106-img0017.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human smooth muscle shows no positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP1-94106-img0018.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/CHCHD2-Antibody-Immunohistochemistry-Paraffin-NBP1-94106-img0019.jpg "Immunohistochemistry-Paraffin: CHCHD2 Antibody [NBP1-94106] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")