| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQQHQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHCHD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP1-94106 | Applications | Species |
|---|---|---|
| Jan C. Lumibao, Payton L. Haak, Vladimir L. Kolossov, Jee-Wei Emily Chen, Jeremy Stutchman, Alejandra Ruiz, Mayandi Sivaguru, Jann N. Sarkaria, Brendan A.C. Harley, Andrew J. Steelman, H. Rex Gaskins CHCHD2 mediates glioblastoma cell proliferation, mitochondrial metabolism, hypoxia-induced invasion and therapeutic resistance International Journal of Oncology 2023-11-01 [PMID: 37654190] | ||
| Lumibao JC CHCHD2 and the tumor microenvironment in glioblastoma Thesis (ICC/IF, WB, Human) | ICC/IF, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CHCHD2 Antibody (NBP1-94106)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.