Recombinant Human CH25H Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CH25H Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 142-247 of Human CH25H partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:WHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CH25H

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CH25H Protein

  • C25H
  • cholesterol 25-hydroxylase
  • Cholesterol 25-monooxygenase
  • EC 1.14.99.38
  • h25OH

Background

This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-140
Species: Hu, Rb, Mu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27352
Species: Hu
Applications: WB, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00009023-Q03
Species: Hu
Applications: WB, ELISA, PA

Publications for CH25H Partial Recombinant Protein (H00009023-Q03) (0)

There are no publications for CH25H Partial Recombinant Protein (H00009023-Q03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CH25H Partial Recombinant Protein (H00009023-Q03) (0)

There are no reviews for CH25H Partial Recombinant Protein (H00009023-Q03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CH25H Partial Recombinant Protein (H00009023-Q03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CH25H Products

Bioinformatics Tool for CH25H Partial Recombinant Protein (H00009023-Q03)

Discover related pathways, diseases and genes to CH25H Partial Recombinant Protein (H00009023-Q03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CH25H Partial Recombinant Protein (H00009023-Q03)

Discover more about diseases related to CH25H Partial Recombinant Protein (H00009023-Q03).
 

Pathways for CH25H Partial Recombinant Protein (H00009023-Q03)

View related products by pathway.

PTMs for CH25H Partial Recombinant Protein (H00009023-Q03)

Learn more about PTMs related to CH25H Partial Recombinant Protein (H00009023-Q03).

Blogs on CH25H

There are no specific blogs for CH25H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CH25H Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CH25H