cGK1/PRKG1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKG1. Source: E. coli
Amino Acid Sequence: LADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PRKG1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87289. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for cGK1/PRKG1 Recombinant Protein Antigen
Background
cGK1/PRKG1, also known as cGMP-dependent protein kinase 1, has two isoforms that are produced by alternative splicing. Isoform Alpha (CGK1-alpha) is 671 amino acids long and 76 kDa. Isoform Beta (CGK1-beta) is 686 amino acids long and approximately 78 kDa. PRKG1 is a Serine/threonine protein kinase that is expressed in placenta and lung. cGK1/PRKG1 is an important player in the Nitric Oxide/cGMP Signaling Pathway; the binding of GMP activates PRKG1, which in turn phosphorylates Serine residues and Threonine residues on various cell proteins, including proteins that regulate calcium levels, smooth muscle contraction, platelet adhesion, circadian rhythm and more. Current research on PRKG1 is being conducted in relation to several diseases and disorders including cystic fibrosis, lymphoma, non-small cell lung carcinoma, Wiskott-Aldrich syndrome, Waterhouse-Friderichsen syndrome and myoglobinuria. PRKG1 has also been shown to have interactions with SMAD4, BMPR2, GKAP1, Natriuretic Peptide Receptor A and TFII-I in pathways such as Gap Junction signaling, eNOS signaling and EDNRB signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AC
Publications for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP) (0)
There are no publications for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP) (0)
There are no reviews for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP) (0)
Additional cGK1/PRKG1 Products
Research Areas for cGK1/PRKG1 Recombinant Protein Antigen (NBP1-87289PEP)
Find related products by research area.
|
Blogs on cGK1/PRKG1