CGI-128 Antibody

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88092] - Staining of human testis shows moderate cytoplasmic positivity.

Product Discontinued

CGI-128 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVA
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIAO2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CGI-128 Antibody

• CGI-128
• family with sequence similarity 96, member B
• MIP18
• mitotic spindle-associated MMXD complex subunit MIP18
• MSS19-interacting protein of 18 kDa
• Protein FAM96B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIAO2B