![Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202511411430.jpg "Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-522 of human cGAS (NP_612450.2). KQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CGAS |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP3-16666 | Applications | Species |
|---|---|---|
| Luo M, Hu Y, Lv D et al. Recurrent Hypoglycemia Impaired Vascular Function in Advanced T2DM Rats by Inducing Pyroptosis Oxidative medicine and cellular longevity Jul 23 2022 [PMID: 35915611] (WB, Rat) Details: Dilution: 1:1000 |
WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for cGAS Antibody (NBP3-16666)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CGAS |
![Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/cGAS-Antibody-Immunohistochemistry-Paraffin-NBP3-16666-img0016.jpg "Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon carcinoma using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/cGAS-Antibody-Immunohistochemistry-Paraffin-NBP3-16666-img0015.jpg "Immunohistochemistry-Paraffin: cGAS Antibody [NBP3-16666] - Human colon carcinoma using cGAS Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202511383754.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202511374111.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-5220251136128.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [NBP3-16666] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202511402720.jpg "Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
![Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-5220251255537.jpg "Western Blot: cGAS Antibody - BSA Free [NBP3-16666] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202517311083.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of NIH/3T3 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202517352726.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of PC-12 cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202517352781.jpg "Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from HeLa cells using cGAS Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.")
![Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202517311063.jpg "Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from THP-1 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
![Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-5220251734523.jpg "Western Blot: cGAS Antibody - BSA Free [cGAS] - Western blot analysis of lysates from HT-29 cells using cGAS Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.")
![Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-16666_rabbit-cgas-pab-52202517311044.jpg "Immunocytochemistry/ Immunofluorescence: cGAS Antibody - BSA Free [cGAS] - Immunofluorescence analysis of U2OS cells using cGAS Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Enzyme Activity Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-enzyme-activity-202202316147.jpg)
![SDS-PAGE Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-sds-page-2022023162028.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/IRF1_AF4715_Western_Blot_5529.jpg)
![Western Blot IRF1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4715_mouse-irf1-affinity-purified-polyclonal-ab-western-blot-16122024101037..png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")