cGAS Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: cGAS Antibody [NBP2-55374] - Staining of human cell line U-2 OS shows localization to microtubule organizing center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Staining of human upper gastrointestinal shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: cGAS Antibody [NBP2-55374] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cGAS Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYER
Specificity
Specificity of human cGAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MB21D1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
cGAS Recombinant Protein Antigen (NBP2-55374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for cGAS Antibody

  • C6orf150
  • c-GAS
  • cyclic GMP-AMP synthase
  • h-cGAS
  • Mab-21 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-23795
Species: Hu, Rt
Applications: WB
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010581-M14
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP1-76977
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-94867
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-81712
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP3-05523
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19618
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF3377
Species: Mu
Applications: WB, IHC
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA

Publications for cGAS Antibody (NBP2-55374) (0)

There are no publications for cGAS Antibody (NBP2-55374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGAS Antibody (NBP2-55374) (0)

There are no reviews for cGAS Antibody (NBP2-55374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for cGAS Antibody (NBP2-55374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional cGAS Products

Bioinformatics Tool for cGAS Antibody (NBP2-55374)

Discover related pathways, diseases and genes to cGAS Antibody (NBP2-55374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGAS Antibody (NBP2-55374)

Discover more about diseases related to cGAS Antibody (NBP2-55374).

Blogs on cGAS

There are no specific blogs for cGAS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MB21D1