cGAS Antibody

Images

 
Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate ...read more
Western Blot: cGAS Antibody [NBP1-70755] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755] - Fetal Liver lysates, Antibody Dilution: 0.2 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755] - Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 0.2 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

cGAS Antibody Summary

Immunogen
Synthetic peptides corresponding to C6ORF150 The peptide sequence was selected from the middle region of C6ORF150. Peptide sequence VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MB21D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C6orf150 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for cGAS Antibody

  • C6orf150
  • c-GAS
  • cyclic GMP-AMP synthase
  • h-cGAS
  • Mab-21 domain containing 1

Background

The exact function of C6orf150 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010581-B01P
Species: Hu
Applications: WB, ELISA
7570-GH
Species: Hu
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-77314
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-91826
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBL1-11832
Species: Hu
NBP1-87363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57838
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39040
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
AF3377
Species: Mu
Applications: WB, IHC
H00004061-D01P
Species: Hu
Applications: WB

Publications for cGAS Antibody (NBP1-70755) (0)

There are no publications for cGAS Antibody (NBP1-70755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGAS Antibody (NBP1-70755) (0)

There are no reviews for cGAS Antibody (NBP1-70755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for cGAS Antibody (NBP1-70755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional cGAS Products

Bioinformatics Tool for cGAS Antibody (NBP1-70755)

Discover related pathways, diseases and genes to cGAS Antibody (NBP1-70755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGAS Antibody (NBP1-70755)

Discover more about diseases related to cGAS Antibody (NBP1-70755).

Blogs on cGAS

There are no specific blogs for cGAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our cGAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MB21D1