cGAS Antibody


Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: cGAS Antibody [NBP1-70755] - Sample Tissue: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate more
Western Blot: cGAS Antibody [NBP1-70755] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755] - Fetal Liver lysates, Antibody Dilution: 0.2 ug/ml.
Western Blot: cGAS Antibody [NBP1-70755] - Sample Type: Jurkat Whole Cell lysates Antibody Dilution: 0.2 ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

cGAS Antibody Summary

Synthetic peptides corresponding to C6ORF150 The peptide sequence was selected from the middle region of C6ORF150. Peptide sequence VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C6orf150 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for cGAS Antibody

  • C6orf150
  • c-GAS
  • cyclic GMP-AMP synthase
  • h-cGAS
  • Mab-21 domain containing 1


The exact function of C6orf150 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for cGAS Antibody (NBP1-70755) (0)

There are no publications for cGAS Antibody (NBP1-70755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cGAS Antibody (NBP1-70755) (0)

There are no reviews for cGAS Antibody (NBP1-70755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for cGAS Antibody (NBP1-70755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional cGAS Products

Bioinformatics Tool for cGAS Antibody (NBP1-70755)

Discover related pathways, diseases and genes to cGAS Antibody (NBP1-70755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for cGAS Antibody (NBP1-70755)

Discover more about diseases related to cGAS Antibody (NBP1-70755).

Blogs on cGAS

There are no specific blogs for cGAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our cGAS Antibody and receive a gift card or discount.


Gene Symbol MB21D1