Ceramide Kinase Like Antibody

Images

 
Western Blot: Ceramide Kinase Like Antibody [NBP1-68988] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ceramide Kinase Like Antibody Summary

Immunogen
Synthetic peptides corresponding to CERKL (ceramide kinase-like) The peptide sequence was selected from the C terminal of CERKL. Peptide sequence ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CERKL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CERKL and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ceramide Kinase Like Antibody

  • ceramide kinase-like protein
  • ceramide kinase-like
  • retinitis pigmentosa 26 (autosomal recessive)
  • RP26

Background

This gene was initially identified as a locus (RP26) associated with an autosomal recessive form of retinitis pigmentosa (arRP) disease. This gene encodes a protein with ceramide kinase-like domains, however, the protein does not phosphorylate ceramide and its target substrate is currently unknown. This protein may be a negative regulator of apoptosis in photoreceptor cells. Mutations in this gene cause a form of retinitis pigmentosa characterized by autosomal recessive cone and rod dystrophy (arCRD). Alternative splicing of this gene results in multiple transcript variants encoding different isoforms and non-coding transcripts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2911
Species: Hu
Applications: WB, ICC/IF
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB120-5422
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
H00002978-R01V
Species: Hu
AF2746
Species: Hu, Mu
Applications: WB, ICC
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-46273
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89932
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-25959
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for Ceramide Kinase Like Antibody (NBP1-68988) (0)

There are no publications for Ceramide Kinase Like Antibody (NBP1-68988).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ceramide Kinase Like Antibody (NBP1-68988) (0)

There are no reviews for Ceramide Kinase Like Antibody (NBP1-68988). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ceramide Kinase Like Antibody (NBP1-68988) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ceramide Kinase Like Products

Bioinformatics Tool for Ceramide Kinase Like Antibody (NBP1-68988)

Discover related pathways, diseases and genes to Ceramide Kinase Like Antibody (NBP1-68988). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ceramide Kinase Like Antibody (NBP1-68988)

Discover more about diseases related to Ceramide Kinase Like Antibody (NBP1-68988).
 

Pathways for Ceramide Kinase Like Antibody (NBP1-68988)

View related products by pathway.

PTMs for Ceramide Kinase Like Antibody (NBP1-68988)

Learn more about PTMs related to Ceramide Kinase Like Antibody (NBP1-68988).
 

Research Areas for Ceramide Kinase Like Antibody (NBP1-68988)

Find related products by research area.

Blogs on Ceramide Kinase Like

There are no specific blogs for Ceramide Kinase Like, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ceramide Kinase Like Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CERKL