CEP97 Antibody

Images

 
Western Blot: CEP97 Antibody [NBP1-83591] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CEP97 Antibody [NBP1-83591] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining in human testis and pancreas tissues using anti-CEP97 antibody. Corresponding CEP97 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CEP97 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN
Specificity
Specificity of human CEP97 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP97
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEP97 Protein (NBP1-83591PEP)
Publications
Read Publications using NBP1-83591.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP97 Antibody

  • 2810403B08Rik
  • centrosomal protein 97kDa
  • centrosomal protein of 97 kDa
  • Cep97
  • FLJ23047
  • FLJ26462
  • Leucine-rich repeat and IQ domain-containing protein 2
  • leucine-rich repeats and IQ motif containing 2
  • LRRIQ2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
MAB32051
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-314
Species: Hu
Applications: WB, IP
NBP2-46403
Species: Hu
Applications: IHC
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33748
Species: Hu
Applications: IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59811
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IP

Publications for CEP97 Antibody (NBP1-83591)(2)

Reviews for CEP97 Antibody (NBP1-83591) (0)

There are no reviews for CEP97 Antibody (NBP1-83591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEP97 Antibody (NBP1-83591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CEP97 Products

Bioinformatics Tool for CEP97 Antibody (NBP1-83591)

Discover related pathways, diseases and genes to CEP97 Antibody (NBP1-83591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP97 Antibody (NBP1-83591)

Discover more about diseases related to CEP97 Antibody (NBP1-83591).
 

Pathways for CEP97 Antibody (NBP1-83591)

View related products by pathway.

Blogs on CEP97

There are no specific blogs for CEP97, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP97 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP97
Entrez
Uniprot