CEP97 Antibody

Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining in human testis and pancreas tissues using anti-CEP97 antibody. Corresponding CEP97 RNA-seq data are presented for the same tissues.

Western Blot: CEP97 Antibody [NBP1-83591] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: CEP97 Antibody [NBP1-83591] - Staining of human cell line A-431 shows localization to cytosol & microtubule organizing center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: CEP97 Antibody [NBP1-83591] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CEP97 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEEAFRFLWNQVRSLQVWQQTVDQRLSSWHTDVPPISSTLVPSKHPLFTQSQESSCDQNADWFIASDVAPQEKSLPEFPDSGFHSSLTEQVHSLQHSLDFEKSSTEGSESSIMGNSIDTVRYGKESDLGDVSEEHGEWN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP97
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEP97 Protein (NBP1-83591PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CEP97 Antibody

• 2810403B08Rik
• centrosomal protein 97kDa
• centrosomal protein of 97 kDa
• Cep97
• FLJ23047
• FLJ26462
• Leucine-rich repeat and IQ domain-containing protein 2
• leucine-rich repeats and IQ motif containing 2
• LRRIQ2

Background

CEP97 (centrosomal protein of 97 kDa) has been identified as part of a complex with CP110. Together, CP110 and CEP97 have been shown to play a role in the assembly of cilia. Loss of CEP97 or CEP110 promotes cilia formation while forced expression inhibits ciliogenesis. CEP97 is also known as leucine-rich repeat and IQ domain-containing protein 2 or LRRIQ2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEP97 Antibody (NBP1-83591)(2)

Publications using NBP1-83591

• Joo K, Kim CG, Lee MS et al. CCDC41 is required for ciliary vesicle docking to the mother centriole Proc Natl Acad Sci U S A 2013-03-25 [PMID: 23530209]
• Cao J, Shen Y, Zhu L et al. miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics. Nat Cell Biol 2012-06-01 [PMID: 22684256]

Bioinformatics

• Gene Symbol: CEP97
• Entrez:
  • 79598(Human)
• Uniprot:
  • Q8IW35(Human)