CEP55 Antibody - BSA Free

Western Blot: CEP55 Antibody [NBP1-91778] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: CEP55 Antibody [NBP1-91778] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & microtubule organizing center.

Immunohistochemistry-Paraffin: CEP55 Antibody [NBP1-91778] - Staining of human testis shows cytoplasmic positivity in seminiferus ducts.

Analysis in human cell line U-251 MG.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEP55 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLVTFQGETENREKVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEP55
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEP55 Protein (NBP1-91778PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CEP55 Antibody - BSA Free

• C10orf3
• cancer/testis antigen 111
• centrosomal protein 55kDa
• centrosomal protein of 55 kDa
• Cep55
• chromosome 10 open reading frame 3
• CT111
• FLJ10540
• Up-regulated in colon cancer 6
• URCC6

Background

CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation. Recruits PDCD6IP and TSG101 to midbody during cytokinesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEP55