CEP164 Antibody


Immunocytochemistry/ Immunofluorescence: CEP164 Antibody [NBP2-68776] - Staining of human cell line SiHa shows localization to centrosome & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

CEP164 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
CEP164 Recombinant Protein Antigen (NBP2-68776PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for CEP164 Antibody

  • centrosomal protein 164kDa
  • FLJ54767


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CEP164 Antibody (NBP2-68776) (0)

There are no publications for CEP164 Antibody (NBP2-68776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP164 Antibody (NBP2-68776) (0)

There are no reviews for CEP164 Antibody (NBP2-68776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CEP164 Antibody (NBP2-68776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CEP164 Antibody (NBP2-68776)

Discover related pathways, diseases and genes to CEP164 Antibody (NBP2-68776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEP164 Antibody (NBP2-68776)

Discover more about diseases related to CEP164 Antibody (NBP2-68776).

Pathways for CEP164 Antibody (NBP2-68776)

View related products by pathway.

PTMs for CEP164 Antibody (NBP2-68776)

Learn more about PTMs related to CEP164 Antibody (NBP2-68776).

Blogs on CEP164

There are no specific blogs for CEP164, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CEP164 Antibody and receive a gift card or discount.


Gene Symbol CEP164