Centrin 3 Antibody - Azide and BSA Free

Western Blot: Centrin 3 Antibody [H00001070-B01P] - Analysis of CETN3 expression in transfected 293T cell line by CETN3 polyclonal antibody. Lane 1: CETN3 transfected lysate(19.50 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Centrin 3 Antibody [H00001070-B01P] - Analysis of purified antibody to CETN3 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Centrin 3 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CETN3 (NP_004356.2, 1 a.a. - 167 a.a.) full-length human protein. MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CETN3
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: It has been used for WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 3 Antibody - Azide and BSA Free

• CDC31 yeast homolog
• CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
• centrin, EF-hand protein, 3 (CDC31 yeast homolog)
• centrin, EF-hand protein, 3
• centrin-3
• EF-hand superfamily member
• MGC12502
• MGC138245

Background

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CETN3
• Uniprot:
  • NP_004356.2(Human)