Centrin 3 Antibody

Images

 
Western Blot: Centrin 3 Antibody [H00001070-B01P] - Analysis of CETN3 expression in transfected 293T cell line by CETN3 polyclonal antibody. Lane 1: CETN3 transfected lysate(19.50 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Centrin 3 Antibody [H00001070-B01P] - Analysis of purified antibody to CETN3 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Centrin 3 Antibody Summary

Immunogen
CETN3 (NP_004356.2, 1 a.a. - 167 a.a.) full-length human protein. MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CETN3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Centrin 3 Antibody

  • CDC31 yeast homolog
  • CEN3centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
  • centrin, EF-hand protein, 3 (CDC31 yeast homolog)
  • centrin, EF-hand protein, 3
  • centrin-3
  • EF-hand superfamily member
  • MGC12502
  • MGC138245

Background

The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14909
Species: Hu
Applications: WB, IP
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-88213
Species: Hu
Applications: IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-13382
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001070-M01
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00008847-P01
Species: Hu
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-2359
Species: Hu
Applications: WB, IHC, IP

Publications for Centrin 3 Antibody (H00001070-B01P) (0)

There are no publications for Centrin 3 Antibody (H00001070-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centrin 3 Antibody (H00001070-B01P) (0)

There are no reviews for Centrin 3 Antibody (H00001070-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Centrin 3 Antibody (H00001070-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Centrin 3 Products

Bioinformatics Tool for Centrin 3 Antibody (H00001070-B01P)

Discover related pathways, diseases and genes to Centrin 3 Antibody (H00001070-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Centrin 3 Antibody (H00001070-B01P)

Discover more about diseases related to Centrin 3 Antibody (H00001070-B01P).
 

Pathways for Centrin 3 Antibody (H00001070-B01P)

View related products by pathway.

Research Areas for Centrin 3 Antibody (H00001070-B01P)

Find related products by research area.

Blogs on Centrin 3

There are no specific blogs for Centrin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Centrin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CETN3
Uniprot