![Immunocytochemistry/Immunofluorescence: CENTB1 Antibody [NBP2-69009] - Staining of human cell line A-431 shows localization to the Golgi apparatus.](http://images.novusbio.com/fullsize2/CENTB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-69009-img0001.jpg "Immunocytochemistry/Immunofluorescence: CENTB1 Antibody [NBP2-69009] - Staining of human cell line A-431 shows localization to the Golgi apparatus.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACAP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, IHC: Retrieval method: HIER pH6 |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
-Flow-Cytometry-NB300-505-img0009.jpg)
-Flow-Cytometry-NB300-505-img0010.jpg)
-Flow-Cytometry-NB300-505-img0011.jpg)
-Flow-Cytometry-NB100-524-img0014.jpg)
-Flow-Cytometry-NB100-524-img0015.jpg)
-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
-Western-Blot-NBP2-01763-img0004.jpg)
-Flow-Cytometry-NBP2-01763-img0005.jpg)
-Immunohistochemistry-Paraffin-NBP2-01763-img0006.jpg)
-Western-Blot-H00002038-M01-img0005.jpg)
-ELISA-H00002038-M01-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-H00002038-M01-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CENTB1 Antibody (NBP2-69009)Discover more about diseases related to CENTB1 Antibody (NBP2-69009).
| Pathways for CENTB1 Antibody (NBP2-69009)View related products by pathway.
|
PTMs for CENTB1 Antibody (NBP2-69009)Learn more about PTMs related to CENTB1 Antibody (NBP2-69009).
| Research Areas for CENTB1 Antibody (NBP2-69009)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACAP1 |
![Immunohistochemistry-Paraffin: CENTB1 Antibody [NBP2-69009] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.](http://images.novusbio.com/fullsize2/CENTB1-Antibody-Immunohistochemistry-NBP2-69009-img0002.jpg "Immunohistochemistry-Paraffin: CENTB1 Antibody [NBP2-69009] - Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center and non-germinal center cells.")
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_17077.jpg)
![Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Immunocytochemistry__Immunofluorescence_17398.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_23861.jpg)
-Flow-Cytometry-NB100-56583-img0005.jpg)
-Flow-Cytometry-NB100-56583-img0006.jpg)
-Flow-Cytometry-NB100-56583-img0007.jpg)
-Immunohistochemistry-Paraffin-NBP1-47659-img0012.jpg)
-Immunohistochemistry-Paraffin-NBP1-47659-img0013.jpg)
-Immunohistochemistry-Paraffin-NBP1-47659-img0014.jpg)
![Western Blot Paxillin [p Tyr118] Antibody](https://images.novusbio.com/images2/Paxillin-[p-Tyr118]-Antibody-Western-Blot-NBP2-24459-img0001.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")