CENPQ Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CENPQ Antibody [NBP2-58745] - Staining of human cell line HeLa shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPQ Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VIMTILSNSIKEKEEIQYHLNFLKKRLLQQCETLKVPPKKMEDLTNVSSLLNMERARDKANEEGLALLQEEI
Specificity
Specificity of human CENPQ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPQ
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CENPQ Recombinant Protein Antigen (NBP2-58745PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CENPQ Antibody

  • C6orf139
  • CENP-QFLJ10545
  • centromere protein Q
  • chromosome 6 open reading frame 139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79664
Species: Hu
Applications: WB, ICC/IF
NBP1-88485
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00378708-P01
Species: Hu
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-77938
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56148
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP1-85687
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75718
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-58745
Species: Hu
Applications: ICC/IF

Publications for CENPQ Antibody (NBP2-58745) (0)

There are no publications for CENPQ Antibody (NBP2-58745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPQ Antibody (NBP2-58745) (0)

There are no reviews for CENPQ Antibody (NBP2-58745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CENPQ Antibody (NBP2-58745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CENPQ Antibody (NBP2-58745)

Discover related pathways, diseases and genes to CENPQ Antibody (NBP2-58745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CENPQ

There are no specific blogs for CENPQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPQ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPQ